KEGG   Mus caroli (Ryukyu mouse): 110297574
Entry
110297574         CDS       T05910                                 

Gene name
Ube3a
Definition
(RefSeq) ubiquitin-protein ligase E3A isoform X1
  KO
K10587  ubiquitin-protein ligase E3 A [EC:2.3.2.26]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04120  Ubiquitin mediated proteolysis
mcal05165  Human papillomavirus infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110297574 (Ube3a)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110297574 (Ube3a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110297574 (Ube3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110297574 (Ube3a)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     110297574 (Ube3a)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  HECT type E3
   110297574 (Ube3a)
SSDB
Motif
Pfam: HECT AZUL
Other DBs
NCBI-GeneID: 110297574
NCBI-ProteinID: XP_021022033
Ensembl: MGP_CAROLIEiJ_G0029813
UniProt: A0A6P5PY42
LinkDB
Position
7
AA seq 870 aa
MATACKRSPGESQSEDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLR
MDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGASNNSEIKMNKKEGKDFKDV
IYLTEEKVYEIYEFCRESEDYSPLIRVIGRIFSSAEALVLSFRKVKQHTKEELKSLQEKD
EDKDEDEKEKAACSAAAMEEDSEASSSRMGDSSQGDNNVQKLGPDDVTVDIDAIRRVYSS
LLANEKLETAFLNALVYLSPNVECDLTYHNVYTRDPNYLNLFIIVMENSNLHSPEYLEMA
LPLFCKAMCKLPLEAQGKLIRLWSKYSADQIRRMMETFQQLITYKVISNEFNSRNLVNDD
DAIVAASKCLKMVYYANVVGGDVDTNHNEEDDEEPIPESSELTLQELLGDERRNKKGPRV
DPLETELGVKTLDCRKPLISFEEFINEPLNDVLEMDKDYTFFKVETENKFSFMTCPFILN
AVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAM
ENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSS
FETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDL
LEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKS
VEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESV
VIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFN
VLLLPEYSSKEKLKERLLKAITYAKGFGML
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggccacagcttgtaaaagatcaccaggagaatcccagtctgaggacattgaagctagc
cgaatgaagcgagcagctgcaaagcatctaatagaacgctactaccatcagttaactgag
ggctgtggaaatgaggcctgcacgaatgagttttgtgcttcctgtccaacttttcttcgt
atggataacaatgcagcagctattaaagcccttgagctttataaaattaatgcaaaactc
tgtgatcctcatccctccaagaaaggagcaagctcagcttaccttgagaactcaaaaggt
gcatctaacaactcagagataaaaatgaacaagaaggaaggaaaagattttaaagatgtg
atttacctaactgaagagaaagtatatgaaatttatgaattttgtagagagagtgaggat
tactcccctttaattcgtgtaattggaagaatattttctagtgctgaggcactggttctg
agctttcggaaagtcaaacagcacactaaggaggaattgaaatctcttcaagaaaaggat
gaagacaaggatgaagatgaaaaggaaaaggctgcatgttctgctgctgctatggaagaa
gactcagaagcatcttcttcaaggatgggtgatagctcacagggagacaacaatgtacaa
aaattaggtcctgatgatgtgactgtggatattgatgctattagaagggtctacagcagt
ttgctcgctaatgaaaaattagaaactgcctttctgaatgcacttgtatatctgtcacct
aacgtggaatgtgatttgacatatcataatgtgtatactcgagatcctaattatctcaat
ttgttcattattgtaatggagaatagtaatctccacagtcctgaatatctagaaatggca
ttgccattattttgcaaagctatgtgtaagctaccccttgaagctcaaggaaaactgata
aggctgtggtctaaatacagtgctgaccagattcggagaatgatggaaacatttcagcaa
cttattacctacaaagtcataagcaatgaatttaatagccgaaatctagtgaatgatgat
gatgccattgttgctgcttcaaagtgtttgaaaatggtttactatgcaaatgtagtggga
ggggatgtggacacaaatcataatgaggaagatgatgaagaacccatacctgagtccagc
gaattaacacttcaggagcttctgggagatgaaagaagaaataagaaaggtcctcgagtg
gatccactagaaaccgaacttggcgttaaaactctagactgtcgaaaaccacttatctcc
tttgaagaattcattaatgaaccactgaatgatgttctagaaatggacaaagattatacc
tttttcaaagttgaaacagagaacaaattctcttttatgacatgtccctttatattgaat
gctgtcacaaagaatctgggattatattatgacaatagaattcgcatgtacagtgaaaga
agaatcactgttctttacagcctagttcaaggacagcagttgaatccgtatttgagactc
aaagtcagacgtgaccatattatagatgatgcactggtccggctagagatgattgctatg
gaaaatcctgcagacttgaagaagcagttgtatgtggaatttgaaggagaacaaggagta
gatgagggaggcgtttctaaagagttttttcagttggttgtggaggaaatttttaatcca
gatattggtatgttcacatatgatgaagctacaaaattattttggtttaatccatcttct
tttgaaactgagggtcagtttactctgattggcatagtcctgggtctggctatttacaat
aactgtatactggatgtccattttcccatggttgtatacaggaagctaatggggaaaaaa
ggaacctttcgtgacttgggagattctcacccagttttatatcagagtttaaaggattta
ttggaatatgaagggagtgtggaagatgatatgatgatcactttccagatatcacagaca
gatctttttggtaacccaatgatgtatgatctaaaagaaaatggtgataaaattccaatt
acaaatgaaaacaggaaggaatttgtcaatctctattcagactacattctcaataaatct
gtagaaaaacaattcaaggcatttcgcagaggttttcatatggtgaccaatgaatcgccc
ttaaaatacttattcagaccagaagaaattgaattgcttatatgtggaagccggaatcta
gatttccaggcactagaagaaactacagagtatgacggtggctatacgagagaatctgtt
gtgattagggagttctgggaaattgttcattcgtttacagatgaacagaaaagactcttt
ctgcagtttacaacaggcacagacagagcacctgttggaggactaggaaaattgaagatg
attatagccaaaaatggcccagacacagaaaggttacctacatctcatacttgctttaat
gtccttttacttccggaatattcaagcaaagaaaaacttaaagagagattgttgaaggcc
atcacatatgccaaaggatttggcatgctgtaa

DBGET integrated database retrieval system