KEGG   Mus caroli (Ryukyu mouse): 110297763
Entry
110297763         CDS       T05910                                 

Gene name
Prkcg
Definition
(RefSeq) protein kinase C gamma type isoform X1
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04150  mTOR signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04310  Wnt signaling pathway
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04613  Neutrophil extracellular trap formation
mcal04650  Natural killer cell mediated cytotoxicity
mcal04666  Fc gamma R-mediated phagocytosis
mcal04670  Leukocyte transendothelial migration
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05031  Amphetamine addiction
mcal05032  Morphine addiction
mcal05143  African trypanosomiasis
mcal05146  Amoebiasis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110297763 (Prkcg)
   04012 ErbB signaling pathway
    110297763 (Prkcg)
   04014 Ras signaling pathway
    110297763 (Prkcg)
   04015 Rap1 signaling pathway
    110297763 (Prkcg)
   04310 Wnt signaling pathway
    110297763 (Prkcg)
   04370 VEGF signaling pathway
    110297763 (Prkcg)
   04066 HIF-1 signaling pathway
    110297763 (Prkcg)
   04020 Calcium signaling pathway
    110297763 (Prkcg)
   04070 Phosphatidylinositol signaling system
    110297763 (Prkcg)
   04071 Sphingolipid signaling pathway
    110297763 (Prkcg)
   04150 mTOR signaling pathway
    110297763 (Prkcg)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110297763 (Prkcg)
   04540 Gap junction
    110297763 (Prkcg)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110297763 (Prkcg)
   04650 Natural killer cell mediated cytotoxicity
    110297763 (Prkcg)
   04666 Fc gamma R-mediated phagocytosis
    110297763 (Prkcg)
   04670 Leukocyte transendothelial migration
    110297763 (Prkcg)
  09152 Endocrine system
   04911 Insulin secretion
    110297763 (Prkcg)
   04929 GnRH secretion
    110297763 (Prkcg)
   04921 Oxytocin signaling pathway
    110297763 (Prkcg)
   04935 Growth hormone synthesis, secretion and action
    110297763 (Prkcg)
   04918 Thyroid hormone synthesis
    110297763 (Prkcg)
   04919 Thyroid hormone signaling pathway
    110297763 (Prkcg)
   04928 Parathyroid hormone synthesis, secretion and action
    110297763 (Prkcg)
   04916 Melanogenesis
    110297763 (Prkcg)
   04925 Aldosterone synthesis and secretion
    110297763 (Prkcg)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110297763 (Prkcg)
  09154 Digestive system
   04970 Salivary secretion
    110297763 (Prkcg)
   04971 Gastric acid secretion
    110297763 (Prkcg)
   04972 Pancreatic secretion
    110297763 (Prkcg)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110297763 (Prkcg)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110297763 (Prkcg)
  09156 Nervous system
   04724 Glutamatergic synapse
    110297763 (Prkcg)
   04727 GABAergic synapse
    110297763 (Prkcg)
   04725 Cholinergic synapse
    110297763 (Prkcg)
   04728 Dopaminergic synapse
    110297763 (Prkcg)
   04726 Serotonergic synapse
    110297763 (Prkcg)
   04720 Long-term potentiation
    110297763 (Prkcg)
   04730 Long-term depression
    110297763 (Prkcg)
   04723 Retrograde endocannabinoid signaling
    110297763 (Prkcg)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110297763 (Prkcg)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110297763 (Prkcg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297763 (Prkcg)
   05206 MicroRNAs in cancer
    110297763 (Prkcg)
   05205 Proteoglycans in cancer
    110297763 (Prkcg)
   05231 Choline metabolism in cancer
    110297763 (Prkcg)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110297763 (Prkcg)
   05214 Glioma
    110297763 (Prkcg)
   05223 Non-small cell lung cancer
    110297763 (Prkcg)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110297763 (Prkcg)
   05022 Pathways of neurodegeneration - multiple diseases
    110297763 (Prkcg)
  09165 Substance dependence
   05031 Amphetamine addiction
    110297763 (Prkcg)
   05032 Morphine addiction
    110297763 (Prkcg)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110297763 (Prkcg)
   05161 Hepatitis B
    110297763 (Prkcg)
   05171 Coronavirus disease - COVID-19
    110297763 (Prkcg)
   05163 Human cytomegalovirus infection
    110297763 (Prkcg)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110297763 (Prkcg)
   05143 African trypanosomiasis
    110297763 (Prkcg)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110297763 (Prkcg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110297763 (Prkcg)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110297763 (Prkcg)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110297763 (Prkcg)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 110297763
NCBI-ProteinID: XP_021022386
Ensembl: MGP_CAROLIEiJ_G0029086
UniProt: A0A6P5PZR9
LinkDB
Position
7
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTKTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPIIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcgggtctgggtcctggcggaggcgactcagaggggggaccccgacccctgttttgc
agaaagggggcgctgaggcagaaggtggtccacgaggtgaagagccacaagttcaccgct
cgtttcttcaagcagccaaccttctgcagtcactgtaccgacttcatctggggcattgga
aagcagggcctgcaatgtcaagtctgtagctttgtggttcaccgccgatgccacgaattt
gtgaccttcgagtgtccaggcgctggaaagggcccccagacggacgaccctcgcaacaag
cacaagttccgtctacacagctacagcagtcccaccttctgcgaccactgtggttccctc
ctttacgggctggtgcaccagggcatgaaatgttcctgctgtgagatgaatgtgcaccgg
cgctgtgtgcgcagcgtgccctccctttgcggtgtggaccacacagagcgccgtggacgt
ctgcaactggaaatccgggctcctacgtcggatgagatccatattactgttggcgaggcc
cggaacctcattcctatggaccccaatggcctgtctgatccctacgtgaaactgaagctg
atcccggaccctcggaacctgacaaaacagaagacaaagacagtgaaagccacactgaat
cccgtgtggaacgagaccttcgtgttcaacctgaagccaggggatgtagagcgccggctc
agtgtggaggtgtgggattgggataggacatcccgaaatgacttcatgggtgccatgtcc
tttggtgtctcagagctactcaaggcccctgtggatggatggtacaagttactgaaccag
gaggagggcgaatattacaatgtaccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgcaattaccccttggaattgtatgagagagtgcggatgggcccctct
tcctcccccatcccttctccatcccccagtcctacggactccaagcgatgcttctttggt
gccagcccaggacgcctgcatatctctgacttcagcttcctcatggttctagggaaaggc
agttttgggaaggtaatgctggcagagcgcagaggctccgatgaactctatgccatcaag
atactgaagaaagacgtcatcgtccaggatgacgatgtagactgcaccctcgtagagaag
cgtgtgctggcattgggaggccgaggtcctggaggccggccacactttctcacgcagctt
cactccacctttcagactccggaccgcctgtattttgtgatggagtacgtcactgggggc
gatttaatgtaccacattcagcaattgggcaagtttaaggagccccatgcagcattctac
gctgcggaaatcgccataggcctcttcttccttcacaaccagggcatcatctacagggac
ctcaagttggataatgtgatgctggatgctgaaggacacatcaagatcacagactttggc
atgtgtaaagagaatgtcttccctgggtccacaacccgcaccttctgtggcaccccagac
tacatagcccctgagatcattgcctatcagccctacgggaagtctgtcgactggtggtct
ttcggggtcctgctgtatgagatgctggcaggacagccaccctttgatggggaagatgag
gaggagttgtttcaagccatcatggaacaaactgtcacctatcccaagtcactttcccgg
gaagctgtggccatctgcaaagggttcctgaccaagcacccaggaaaacgcctgggctcc
gggccagatggggaacccatcatccgagctcacggctttttccgttggatcgattgggag
aggttggagagactggaaattgcgcctcctttcagaccacgtccgtgtggccgcagtggc
gaaaactttgacaagttcttcacgcgggcagcgccagcattgaccccgccagaccgcttg
gtcctagccagcatcgaccaagctgatttccagggctttacttatgtgaacccggacttc
gtgcacccagatgcccgcagccccacaagccctgtgcccgtgcctgtcatgtaa

KEGG   Mus caroli (Ryukyu mouse): 110297826
Entry
110297826         CDS       T05910                                 

Gene name
Prkcb
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04062  Chemokine signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04150  mTOR signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04310  Wnt signaling pathway
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04613  Neutrophil extracellular trap formation
mcal04650  Natural killer cell mediated cytotoxicity
mcal04662  B cell receptor signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04670  Leukocyte transendothelial migration
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04931  Insulin resistance
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04973  Carbohydrate digestion and absorption
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05031  Amphetamine addiction
mcal05032  Morphine addiction
mcal05140  Leishmaniasis
mcal05143  African trypanosomiasis
mcal05146  Amoebiasis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110297826 (Prkcb)
   04012 ErbB signaling pathway
    110297826 (Prkcb)
   04014 Ras signaling pathway
    110297826 (Prkcb)
   04015 Rap1 signaling pathway
    110297826 (Prkcb)
   04310 Wnt signaling pathway
    110297826 (Prkcb)
   04370 VEGF signaling pathway
    110297826 (Prkcb)
   04064 NF-kappa B signaling pathway
    110297826 (Prkcb)
   04066 HIF-1 signaling pathway
    110297826 (Prkcb)
   04020 Calcium signaling pathway
    110297826 (Prkcb)
   04070 Phosphatidylinositol signaling system
    110297826 (Prkcb)
   04071 Sphingolipid signaling pathway
    110297826 (Prkcb)
   04150 mTOR signaling pathway
    110297826 (Prkcb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110297826 (Prkcb)
   04540 Gap junction
    110297826 (Prkcb)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110297826 (Prkcb)
   04650 Natural killer cell mediated cytotoxicity
    110297826 (Prkcb)
   04662 B cell receptor signaling pathway
    110297826 (Prkcb)
   04666 Fc gamma R-mediated phagocytosis
    110297826 (Prkcb)
   04670 Leukocyte transendothelial migration
    110297826 (Prkcb)
   04062 Chemokine signaling pathway
    110297826 (Prkcb)
  09152 Endocrine system
   04911 Insulin secretion
    110297826 (Prkcb)
   04929 GnRH secretion
    110297826 (Prkcb)
   04912 GnRH signaling pathway
    110297826 (Prkcb)
   04921 Oxytocin signaling pathway
    110297826 (Prkcb)
   04935 Growth hormone synthesis, secretion and action
    110297826 (Prkcb)
   04918 Thyroid hormone synthesis
    110297826 (Prkcb)
   04919 Thyroid hormone signaling pathway
    110297826 (Prkcb)
   04928 Parathyroid hormone synthesis, secretion and action
    110297826 (Prkcb)
   04916 Melanogenesis
    110297826 (Prkcb)
   04925 Aldosterone synthesis and secretion
    110297826 (Prkcb)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110297826 (Prkcb)
  09154 Digestive system
   04970 Salivary secretion
    110297826 (Prkcb)
   04971 Gastric acid secretion
    110297826 (Prkcb)
   04972 Pancreatic secretion
    110297826 (Prkcb)
   04973 Carbohydrate digestion and absorption
    110297826 (Prkcb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110297826 (Prkcb)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110297826 (Prkcb)
  09156 Nervous system
   04724 Glutamatergic synapse
    110297826 (Prkcb)
   04727 GABAergic synapse
    110297826 (Prkcb)
   04725 Cholinergic synapse
    110297826 (Prkcb)
   04728 Dopaminergic synapse
    110297826 (Prkcb)
   04726 Serotonergic synapse
    110297826 (Prkcb)
   04720 Long-term potentiation
    110297826 (Prkcb)
   04730 Long-term depression
    110297826 (Prkcb)
   04723 Retrograde endocannabinoid signaling
    110297826 (Prkcb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110297826 (Prkcb)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110297826 (Prkcb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297826 (Prkcb)
   05206 MicroRNAs in cancer
    110297826 (Prkcb)
   05205 Proteoglycans in cancer
    110297826 (Prkcb)
   05231 Choline metabolism in cancer
    110297826 (Prkcb)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110297826 (Prkcb)
   05214 Glioma
    110297826 (Prkcb)
   05223 Non-small cell lung cancer
    110297826 (Prkcb)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110297826 (Prkcb)
   05022 Pathways of neurodegeneration - multiple diseases
    110297826 (Prkcb)
  09165 Substance dependence
   05031 Amphetamine addiction
    110297826 (Prkcb)
   05032 Morphine addiction
    110297826 (Prkcb)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110297826 (Prkcb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110297826 (Prkcb)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110297826 (Prkcb)
   05161 Hepatitis B
    110297826 (Prkcb)
   05171 Coronavirus disease - COVID-19
    110297826 (Prkcb)
   05164 Influenza A
    110297826 (Prkcb)
   05163 Human cytomegalovirus infection
    110297826 (Prkcb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110297826 (Prkcb)
   05140 Leishmaniasis
    110297826 (Prkcb)
   05143 African trypanosomiasis
    110297826 (Prkcb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110297826 (Prkcb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110297826 (Prkcb)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110297826 (Prkcb)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110297826 (Prkcb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 110297826
NCBI-ProteinID: XP_021022507
Ensembl: MGP_CAROLIEiJ_G0030422
UniProt: A0A6P5Q6P4
LinkDB
Position
7
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcacggtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgtcaagtctgctgctttgttgtacacaagcgctgccatgag
ttcgtcacgttctcctgccctggtgcggacaagggcccggcctctgatgacccccggagc
aaacacaagtttaagatccacacctactccagtcctaccttctgtgaccactgtggatca
ctcctgtatggacttatccaccaggggatgaaatgcgacacctgtatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctctgcggcactgaccacacggaacgccgcggc
cgcatctatatccaggcccacatcgacagagaggttctcattgttgttgtaagagatgct
aaaaatctggtacctatggaccccaatggcttgtcagatccctacgttaaactgaaactg
atccctgatcccaaaagtgagagcaaacagaagaccaagaccatcaagtgctccctcaat
ccagagtggaatgaaaccttcagatttcagctgaaggaatcagacaaagacagaagactg
tctgtagagatctgggattgggacctgaccagcaggaatgacttcatgggatctctgtcg
tttgggatttcagaactacagaaagccggtgtggatggctggttcaagttactaagccag
gaagagggtgaatacttcaatgtgcccgtgccacctgaaggaagcgagggcaatgaagag
ctgcggcagaagtttgagagagccaagattggccaaggtaccaaggctccagaagaaaag
acagctaacactatctccaaatttgacaacaatggcaacagggaccggatgaaactgacc
gattttaacttcctgatggtgctggggaaaggcagctttggcaaggtcatgctctccgag
cggaagggtacagatgagctctatgctgtgaagatcctgaagaaggatgtggtgatccaa
gatgacgatgtggagtgcaccatggtggagaaacgggtgctggccctgcctgggaagccc
cccttcctgactcagcttcattcctgcttccagaccatggaccgcctgtactttgtgatg
gagtatgtgaacgggggcgacctcatgtaccacatccaacaagttggccgtttcaaggag
ccccatgctgtattttacgctgcagagattgccatcggtctgttcttcttgcagagcaag
ggcattatttaccgcgacctgaaacttgacaacgtgatgctggattctgaggggcacatc
aaaatcgctgactttggcatgtgtaaggagaacatctgggatggggtgacaaccaagaca
ttctgtggcactccggactacattgccccagagatcattgcttatcagccctacgggaag
tctgtggactggtgggcatttggagtcctgctgtatgaaatgttggctggccaggcaccg
tttgaaggggaggacgaggatgaacttttccagtcaatcatggaacacaatgtggcgtat
cccaagtccatgtccaaggaagccgtggcaatctgcaaagggctaatgaccaaacaccca
ggcaagcgcctgggttgtgggcctgaaggggaacgagacattaaggagcatgcgtttttc
cggtatattgactgggagaaactcgaacgcaaggagattcagccaccttataaaccaaaa
gcttgtgggcgaaacgctgaaaacttcgaccggtttttcacccgccatccaccagtccta
acacctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

KEGG   Mus caroli (Ryukyu mouse): 110304357
Entry
110304357         CDS       T05910                                 

Gene name
Prkca
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04310  Wnt signaling pathway
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04613  Neutrophil extracellular trap formation
mcal04650  Natural killer cell mediated cytotoxicity
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04670  Leukocyte transendothelial migration
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05031  Amphetamine addiction
mcal05032  Morphine addiction
mcal05143  African trypanosomiasis
mcal05146  Amoebiasis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110304357 (Prkca)
   04012 ErbB signaling pathway
    110304357 (Prkca)
   04014 Ras signaling pathway
    110304357 (Prkca)
   04015 Rap1 signaling pathway
    110304357 (Prkca)
   04310 Wnt signaling pathway
    110304357 (Prkca)
   04370 VEGF signaling pathway
    110304357 (Prkca)
   04066 HIF-1 signaling pathway
    110304357 (Prkca)
   04020 Calcium signaling pathway
    110304357 (Prkca)
   04070 Phosphatidylinositol signaling system
    110304357 (Prkca)
   04072 Phospholipase D signaling pathway
    110304357 (Prkca)
   04071 Sphingolipid signaling pathway
    110304357 (Prkca)
   04151 PI3K-Akt signaling pathway
    110304357 (Prkca)
   04150 mTOR signaling pathway
    110304357 (Prkca)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110304357 (Prkca)
   04540 Gap junction
    110304357 (Prkca)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110304357 (Prkca)
   04650 Natural killer cell mediated cytotoxicity
    110304357 (Prkca)
   04664 Fc epsilon RI signaling pathway
    110304357 (Prkca)
   04666 Fc gamma R-mediated phagocytosis
    110304357 (Prkca)
   04670 Leukocyte transendothelial migration
    110304357 (Prkca)
  09152 Endocrine system
   04911 Insulin secretion
    110304357 (Prkca)
   04929 GnRH secretion
    110304357 (Prkca)
   04912 GnRH signaling pathway
    110304357 (Prkca)
   04921 Oxytocin signaling pathway
    110304357 (Prkca)
   04926 Relaxin signaling pathway
    110304357 (Prkca)
   04935 Growth hormone synthesis, secretion and action
    110304357 (Prkca)
   04918 Thyroid hormone synthesis
    110304357 (Prkca)
   04919 Thyroid hormone signaling pathway
    110304357 (Prkca)
   04928 Parathyroid hormone synthesis, secretion and action
    110304357 (Prkca)
   04916 Melanogenesis
    110304357 (Prkca)
   04925 Aldosterone synthesis and secretion
    110304357 (Prkca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110304357 (Prkca)
   04270 Vascular smooth muscle contraction
    110304357 (Prkca)
  09154 Digestive system
   04970 Salivary secretion
    110304357 (Prkca)
   04971 Gastric acid secretion
    110304357 (Prkca)
   04972 Pancreatic secretion
    110304357 (Prkca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110304357 (Prkca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110304357 (Prkca)
  09156 Nervous system
   04724 Glutamatergic synapse
    110304357 (Prkca)
   04727 GABAergic synapse
    110304357 (Prkca)
   04725 Cholinergic synapse
    110304357 (Prkca)
   04728 Dopaminergic synapse
    110304357 (Prkca)
   04726 Serotonergic synapse
    110304357 (Prkca)
   04720 Long-term potentiation
    110304357 (Prkca)
   04730 Long-term depression
    110304357 (Prkca)
   04723 Retrograde endocannabinoid signaling
    110304357 (Prkca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110304357 (Prkca)
  09158 Development and regeneration
   04360 Axon guidance
    110304357 (Prkca)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110304357 (Prkca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304357 (Prkca)
   05206 MicroRNAs in cancer
    110304357 (Prkca)
   05205 Proteoglycans in cancer
    110304357 (Prkca)
   05231 Choline metabolism in cancer
    110304357 (Prkca)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110304357 (Prkca)
   05214 Glioma
    110304357 (Prkca)
   05223 Non-small cell lung cancer
    110304357 (Prkca)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110304357 (Prkca)
   05022 Pathways of neurodegeneration - multiple diseases
    110304357 (Prkca)
  09165 Substance dependence
   05031 Amphetamine addiction
    110304357 (Prkca)
   05032 Morphine addiction
    110304357 (Prkca)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110304357 (Prkca)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110304357 (Prkca)
   05161 Hepatitis B
    110304357 (Prkca)
   05171 Coronavirus disease - COVID-19
    110304357 (Prkca)
   05164 Influenza A
    110304357 (Prkca)
   05163 Human cytomegalovirus infection
    110304357 (Prkca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110304357 (Prkca)
   05143 African trypanosomiasis
    110304357 (Prkca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110304357 (Prkca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110304357 (Prkca)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110304357 (Prkca)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110304357 (Prkca)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110304357 (Prkca)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    110304357 (Prkca)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 110304357
NCBI-ProteinID: XP_021031327
Ensembl: MGP_CAROLIEiJ_G0017341
UniProt: A0A6P5QKV6
LinkDB
Position
11
AA seq 672 aa
MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgtttacccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcatgaggtgaaagaccacaaattcatc
gcccgcttcttcaagcaacccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcataagaggtgccatgag
ttcgtcactttctcttgtcccggtgcggacaagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacatacggaagccctaccttctgcgatcactgtgggtcc
ctgctctatggacttatccaccaagggatgaaatgtgacacctgcgacatgaatgttcac
aagcagtgtgtgatcaatgtccctagcctctgcggaatggatcacactgagaagaggggg
aggatttatctgaaggctgaggtcactgatgaaaagctccacgtcacggtacgagatgca
aaaaatctaatccctatggatccaaatgggctttcggatccttacgtgaagctgaaactt
attcctgaccccaagaatgagagcaaacagaaaaccaaaactattcgctccacactgaat
cctcagtggaatgagtccttcacgttcaaattaaaaccttcagacaaagaccggcgactg
tctgtagaaatctgggactgggatcggaccactcggaatgacttcatgggttccctttcc
tttggtgtctcagagctgatgaagatgccggccagtggatggtataagctgctcaaccaa
gaagagggcgaatactacaatgtgcccattccagaaggagatgaagaaggcaacatggaa
ctcaggcagaagtttgagaaagccaagctaggccctgctggtaacaaagtcatcagccct
tcagaagacagaaagcaaccatccaacaacctggacagagtgaaactcacagacttcaac
ttcctcatggtgctggggaaggggagttttgggaaggtgatgcttgctgacaggaaggga
acggaggaactgtacgccatcaagatcctgaagaaggacgtagtgatccaggacgacgac
gtggagtgcaccatggtggagaagcgcgtgctggccctgctggacaagccgccattcctg
acacagctgcactcctgcttccagacagtggaccggctgtacttcgtcatggaatacgtc
aacggcggggacctcatgtaccacattcagcaagtcgggaaatttaaggagccacaagca
gtattctacgcagctgagatctccatcggactgttcttccttcataaaagagggatcatt
tacagggatctgaagctggacaatgtcatgctggactcagaagggcacatcaaaatcgct
gacttcgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccggactacattgccccagagataatcgcttaccagccgtacgggaagtctgtggat
tggtgggcatacggtgtgctgctgtacgagatgctagccgggcagcctccgtttgatggt
gaagatgaagatgaactgtttcagtctataatggagcacaatgtgtcctaccccaaatcc
ttgtccaaggaagctgtctccatctgcaaaggacttatgaccaaacaccctgccaagcgg
ctgggctgcgggccggagggagagagggatgtcagagagcatgccttcttcaggaggatc
gactgggagaaactggagaacagggagatacaaccaccattcaaacccaaagtgtgtggc
aaaggagcagaaaactttgacaagttcttcacgcgagggcagcctgtcttaacaccacca
gatcagctggtcattgctaacatagaccaatctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcacccaatcttgcaaagtgcagtatga

DBGET integrated database retrieval system