KEGG   Mus caroli (Ryukyu mouse): 110297825
Entry
110297825         CDS       T05910                                 

Gene name
Igf1r
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04114  Oocyte meiosis
mcal04140  Autophagy - animal
mcal04144  Endocytosis
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04730  Long-term depression
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110297825 (Igf1r)
   04014 Ras signaling pathway
    110297825 (Igf1r)
   04015 Rap1 signaling pathway
    110297825 (Igf1r)
   04066 HIF-1 signaling pathway
    110297825 (Igf1r)
   04068 FoxO signaling pathway
    110297825 (Igf1r)
   04151 PI3K-Akt signaling pathway
    110297825 (Igf1r)
   04152 AMPK signaling pathway
    110297825 (Igf1r)
   04150 mTOR signaling pathway
    110297825 (Igf1r)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110297825 (Igf1r)
   04140 Autophagy - animal
    110297825 (Igf1r)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110297825 (Igf1r)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110297825 (Igf1r)
   04520 Adherens junction
    110297825 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    110297825 (Igf1r)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110297825 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    110297825 (Igf1r)
  09156 Nervous system
   04730 Long-term depression
    110297825 (Igf1r)
  09149 Aging
   04211 Longevity regulating pathway
    110297825 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    110297825 (Igf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297825 (Igf1r)
   05202 Transcriptional misregulation in cancer
    110297825 (Igf1r)
   05205 Proteoglycans in cancer
    110297825 (Igf1r)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110297825 (Igf1r)
   05214 Glioma
    110297825 (Igf1r)
   05218 Melanoma
    110297825 (Igf1r)
   05215 Prostate cancer
    110297825 (Igf1r)
   05224 Breast cancer
    110297825 (Igf1r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110297825 (Igf1r)
   01522 Endocrine resistance
    110297825 (Igf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110297825 (Igf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110297825 (Igf1r)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110297825 (Igf1r)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   110297825 (Igf1r)
CD molecules [BR:mcal04090]
 Proteins
  110297825 (Igf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD B2 DUF4476
Other DBs
NCBI-GeneID: 110297825
NCBI-ProteinID: XP_021022505
Ensembl: MGP_CAROLIEiJ_G0029853
UniProt: A0A6P5Q006
LinkDB
Position
7
AA seq 1373 aa
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGD
LCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSDSDGFVIHD
DECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLYR
HNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERRRRDVMQVANTTMSSRSRNTTVADTYNITDPEEFETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAA
RNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSF
GVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPS
FLEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMELEMEPENMESVPLDPSASSASL
PLPERHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4122 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctctctctggccgacgagtggagaaatctgtgggcccggcattgacattcgc
aacgactatcagcagctgaagcgcctggaaaactgcacggtgatcgagggcttcctccac
atcctgctcatctccaaggccgaggactaccgaagctaccgcttccccaagctcaccgtc
atcactgagtacttgctgctcttccgagtggctggccttgagagcctgggagacctcttc
cccaacctcacagtcatccggggctggaaactcttctacaactacgccttggtcatcttc
gagatgaccaatctcaaggatattgggctttataatctgaggaacattacccggggggcc
atcaggattgagaagaacgccgacctctgttacctctccaccatagactggtctctcatc
ttggatgcggtgtccaataactacattgtggggaacaagcccccaaaggaatgtggggac
ctgtgtccagggacattggaggagaagcccatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaatcgttgccagaaaatgtgcccaagtgtgtgcggg
aagcgagcctgcaccgagaacaacgagtgctgccacccggagtgcctgggcagctgccac
acaccggatgacaacacaacctgcgtggcctgcagacactactactacaaaggcgtgtgt
gtgcccgcctgcccgcctggcacctacaggttcgagggctggcgctgtgtggaccgcgat
ttctgcgccaacatccccaacgctgagagcagtgactcggatggcttcgttatccacgac
gatgagtgcatgcaggagtgtccctcaggcttcatccgcaacagcacccagagcatgtac
tgtatcccctgtgaaggcccctgccccaaagtctgcggcgatgaagagaagaaaacgaaa
accatcgattcggtgacttctgctcaaatgctccaaggatgcaccatcttgaagggcaat
ctgcttattaacatccggcgaggcaataacattgcctcggagctggagaacttcatgggg
ctcatcgaggtggtgaccggctacgtgaagatccgccattctcatgccttggtctccttg
tccttcctgaagaacctccgtctcatcttaggagaggagcagctggaagggaactactcc
ttctatgtcctggacaaccagaacttgcagcagctgtgggactggaaccaccggaacctg
accgtcaggtcggggaagatgtactttgctttcaatcccaagctgtgtgtctctgaaatt
taccgcatggaggaagtgaccggaaccaagggacgccagagcaaaggggacataaatacc
aggaacaacggagagcgagcttcctgtgaaagtgatgttctccgtttcacctctaccacg
acctggaagaaccgaatcatcattacgtggcaccggtaccggccgccggactaccgggat
ctcatcagcttcacagtttactacaaggaggcaccctttaaaaacgttacggaatatgac
gggcaggatgcctgtggctccaacagctggaacatggtggatgtagacctgcctccgaac
aaggagggcgagcctggcattttactgcatgggctgaagccctggacccagtatgctgtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccacatccgtggggccaaaagt
gaaatcttgtacattcgcaccaatgcttcagtcccttccattcccctagatgtcctctcg
gcatcaaactcttcctctcagctgattgtgaagtggaatcccccaactctgcccaatggt
aacttgagttactacattgtgaggtggcagcggcagccccaggatggttacctgtaccgg
cacaactactgctctaaagacaaaatacccatcagaaagtacgccgatggtaccatcgac
gtggaggaggtgacggaaaatcccaagacagaagtgtgtggtggtgataaagggccatgc
tgcgcttgccctaaaactgaagctgagaagcaggctgagaaggaggaggccgagtaccgt
aaagtctttgagaatttccttcacaattccatctttgtgcccaggcccgaaaggaggcgg
agagacgtcatgcaagtggccaacacgaccatgtccagccgaagcaggaacaccacagta
gctgacacctacaatatcacagacccggaggagttcgagacagagtaccctttctttgag
agcagagtggataacaaggagaggactgtcatctccaacctccggcctttcactctgtac
cgaatcgatatccacagctgcaaccacgaggctgagaagctgggctgcagtgcctccaac
ttcgtctttgcaagaaccatgccagcagaaggagctgatgatatccctggcccggtgacc
tgggagccaagacccgaaaactccatctttttaaagtggccagaacccgagaaccccaat
ggattgatcctaatgtatgaaattaaatacgggtcacaagttgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtacggaggggccaaacttaaccgtctaaacccaggg
aactatacagcccggattcaggctacctccctctctgggaatgggtcatggacagatcct
gtgttcttctatgtcccggccaaaacgacgtatgaaaacttcatgcatctgatcattgct
ctgccggttgccatcctgctgatcgttggggggctggttatcatgctgtatgtcttccat
agaaagagaaataacagcaggttgggcaatggagtgctgtatgcttctgtgaaccccgag
tatttcagcgcagctgatgtgtacgtgcctgatgaatgggaggtagctcgagagaagatc
accatgaaccgggagctcggacaagggtcctttgggatggtctatgaaggagtggccaag
ggtgtggtcaaggatgaacccgaaaccagagtggccatcaagacggtgaacgaggctgca
agtatgcgtgaaagaatcgagtttctcaacgaggcctcggtgatgaaggaattcaattgt
caccatgtggtccggttgctgggtgtggtatcccaaggccagcccaccctggtcatcatg
gaactaatgacacgtggcgatctcaaaagttatctccggtctctaaggccagaagtggag
cagaataatctagtcctcattcctccgagcttaagcaagatgatccagatggctggagag
atcgcagatggcatggcctacctcaatgccaacaagttcgtccacagagaccttgctgct
aggaactgcatggtagccgaagatttcacggtcaaaattggagattttggtatgacacga
gacatctacgagacggactactaccggaaaggtgggaaagggttgctgcctgtgcgctgg
atgtctcccgagtccctcaaggatggcgtcttcactactcattctgatgtctggtccttc
ggggtcgtcctctgggagatcgccacgctggctgagcagccctaccagggcttgtccaac
gagcaagttcttcgtttcgtcatggagggcggccttctggacaagccggacaactgcccc
gatatgctgtttgaacttatgcgcatgtgctggcagtataaccccaagatgcggccctcc
ttcctggagatcatcggcagcatcaaggatgaaatggagcccagcttccaggaggtctcc
ttctactacagcgaggagaacaagcctcccgagccggaagagctggagatggagctggag
atggagcccgagaacatggagagcgtcccactggacccctcagcctcctcagcctccctg
cctctgcctgaaagacactcaggacacaaggctgagaatggcccgggccctggtgtgctg
gttcttcgtgccagttttgatgagagacagccttacgctcacatgaacgggggacgtgcc
aacgagagggccttgcctctgccccagtcctcgacctgctga

DBGET integrated database retrieval system