KEGG   Mus caroli (Ryukyu mouse): 110297836
Entry
110297836         CDS       T05910                                 

Gene name
Mapk3
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04350  TGF-beta signaling pathway
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04371  Apelin signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04540  Gap junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04668  TNF signaling pathway
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04722  Neurotrophin signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04930  Type II diabetes mellitus
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal05010  Alzheimer disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05034  Alcoholism
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110297836 (Mapk3)
   04012 ErbB signaling pathway
    110297836 (Mapk3)
   04014 Ras signaling pathway
    110297836 (Mapk3)
   04015 Rap1 signaling pathway
    110297836 (Mapk3)
   04350 TGF-beta signaling pathway
    110297836 (Mapk3)
   04370 VEGF signaling pathway
    110297836 (Mapk3)
   04371 Apelin signaling pathway
    110297836 (Mapk3)
   04668 TNF signaling pathway
    110297836 (Mapk3)
   04066 HIF-1 signaling pathway
    110297836 (Mapk3)
   04068 FoxO signaling pathway
    110297836 (Mapk3)
   04072 Phospholipase D signaling pathway
    110297836 (Mapk3)
   04071 Sphingolipid signaling pathway
    110297836 (Mapk3)
   04024 cAMP signaling pathway
    110297836 (Mapk3)
   04022 cGMP-PKG signaling pathway
    110297836 (Mapk3)
   04151 PI3K-Akt signaling pathway
    110297836 (Mapk3)
   04150 mTOR signaling pathway
    110297836 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110297836 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110297836 (Mapk3)
   04210 Apoptosis
    110297836 (Mapk3)
   04218 Cellular senescence
    110297836 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110297836 (Mapk3)
   04520 Adherens junction
    110297836 (Mapk3)
   04540 Gap junction
    110297836 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    110297836 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110297836 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110297836 (Mapk3)
   04613 Neutrophil extracellular trap formation
    110297836 (Mapk3)
   04620 Toll-like receptor signaling pathway
    110297836 (Mapk3)
   04621 NOD-like receptor signaling pathway
    110297836 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    110297836 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    110297836 (Mapk3)
   04660 T cell receptor signaling pathway
    110297836 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    110297836 (Mapk3)
   04659 Th17 cell differentiation
    110297836 (Mapk3)
   04657 IL-17 signaling pathway
    110297836 (Mapk3)
   04662 B cell receptor signaling pathway
    110297836 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    110297836 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    110297836 (Mapk3)
   04062 Chemokine signaling pathway
    110297836 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110297836 (Mapk3)
   04929 GnRH secretion
    110297836 (Mapk3)
   04912 GnRH signaling pathway
    110297836 (Mapk3)
   04915 Estrogen signaling pathway
    110297836 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    110297836 (Mapk3)
   04917 Prolactin signaling pathway
    110297836 (Mapk3)
   04921 Oxytocin signaling pathway
    110297836 (Mapk3)
   04926 Relaxin signaling pathway
    110297836 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    110297836 (Mapk3)
   04919 Thyroid hormone signaling pathway
    110297836 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    110297836 (Mapk3)
   04916 Melanogenesis
    110297836 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110297836 (Mapk3)
   04270 Vascular smooth muscle contraction
    110297836 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110297836 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110297836 (Mapk3)
   04725 Cholinergic synapse
    110297836 (Mapk3)
   04726 Serotonergic synapse
    110297836 (Mapk3)
   04720 Long-term potentiation
    110297836 (Mapk3)
   04730 Long-term depression
    110297836 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    110297836 (Mapk3)
   04722 Neurotrophin signaling pathway
    110297836 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    110297836 (Mapk3)
   04380 Osteoclast differentiation
    110297836 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110297836 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297836 (Mapk3)
   05206 MicroRNAs in cancer
    110297836 (Mapk3)
   05205 Proteoglycans in cancer
    110297836 (Mapk3)
   05203 Viral carcinogenesis
    110297836 (Mapk3)
   05230 Central carbon metabolism in cancer
    110297836 (Mapk3)
   05231 Choline metabolism in cancer
    110297836 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110297836 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110297836 (Mapk3)
   05212 Pancreatic cancer
    110297836 (Mapk3)
   05225 Hepatocellular carcinoma
    110297836 (Mapk3)
   05226 Gastric cancer
    110297836 (Mapk3)
   05214 Glioma
    110297836 (Mapk3)
   05216 Thyroid cancer
    110297836 (Mapk3)
   05221 Acute myeloid leukemia
    110297836 (Mapk3)
   05220 Chronic myeloid leukemia
    110297836 (Mapk3)
   05218 Melanoma
    110297836 (Mapk3)
   05211 Renal cell carcinoma
    110297836 (Mapk3)
   05219 Bladder cancer
    110297836 (Mapk3)
   05215 Prostate cancer
    110297836 (Mapk3)
   05213 Endometrial cancer
    110297836 (Mapk3)
   05224 Breast cancer
    110297836 (Mapk3)
   05223 Non-small cell lung cancer
    110297836 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110297836 (Mapk3)
   05020 Prion disease
    110297836 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    110297836 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    110297836 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110297836 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110297836 (Mapk3)
   04934 Cushing syndrome
    110297836 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110297836 (Mapk3)
   05135 Yersinia infection
    110297836 (Mapk3)
   05133 Pertussis
    110297836 (Mapk3)
   05152 Tuberculosis
    110297836 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110297836 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    110297836 (Mapk3)
   05161 Hepatitis B
    110297836 (Mapk3)
   05160 Hepatitis C
    110297836 (Mapk3)
   05171 Coronavirus disease - COVID-19
    110297836 (Mapk3)
   05164 Influenza A
    110297836 (Mapk3)
   05163 Human cytomegalovirus infection
    110297836 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110297836 (Mapk3)
   05165 Human papillomavirus infection
    110297836 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110297836 (Mapk3)
   05140 Leishmaniasis
    110297836 (Mapk3)
   05142 Chagas disease
    110297836 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110297836 (Mapk3)
   01524 Platinum drug resistance
    110297836 (Mapk3)
   01522 Endocrine resistance
    110297836 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110297836 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110297836 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110297836 (Mapk3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110297836 (Mapk3)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110297836 (Mapk3)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     110297836 (Mapk3)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110297836 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 110297836
NCBI-ProteinID: XP_021022526
Ensembl: MGP_CAROLIEiJ_G0030461
UniProt: A0A6P5PUY4
LinkDB
Position
7
AA seq 380 aa
MAAAAAAPGGGGGEPRGTAGVVPVVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPEGP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctccggggggcgggggcggggagcccaggggaactgctggg
gtcgtcccggtggtcccgggggaggtggaggtggtgaaggggcagccattcgacgtgggc
ccacgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tatgaccacgtgcgcaagaccagagtggccatcaagaagatcagcccctttgagcatcaa
acctactgtcagcgcacgctgagggagatccagatcctgctgcgattccgccatgagaat
gttataggcatccgagacatcctcagagcacccaccctggaagccatgagagatgtttac
attgttcaggacctcatggagacagacctgtacaagctgcttaaaagccagcagctgagc
aatgaccacatctgctacttcctctaccagatcctccggggcctcaagtacatacactca
gccaatgtgctgcaccgggacctgaagccctccaatctgcttatcaacaccacctgcgac
cttaagatctgcgattttggcctggcccggattgctgaccctgaacatgaccacactggc
tttctgacagagtatgtggccacacgctggtaccgagccccagagatcatgcttaattcc
aagggctacaccaaatccatcgacatctggtctgtgggctgcattctggccgagatgctc
tctaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctaggt
atcttgggttccccatcccaggaggaccttaattgcatcattaacatgaaggctcgaaac
tacctgcagtctctgccctcgaaaaccaaggtggcttgggccaagctctttcctaaatct
gactccaaagctcttgacctgctggaccggatgttaaccttcaacccaaacaagcgcatc
acagtagaggaagcactggctcacccgtacctggaacagtactacgatccgacagatgag
ccagtggccgaggagccattcaccttcgacatggagctggacgacctccccaaggagcgg
ctgaaggagctgatcttccaggagacagcccgcttccagccaggggcgccagagggcccc
taa

KEGG   Mus caroli (Ryukyu mouse): 110311382
Entry
110311382         CDS       T05910                                 

Gene name
Mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04350  TGF-beta signaling pathway
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04371  Apelin signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04540  Gap junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04668  TNF signaling pathway
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04722  Neurotrophin signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04930  Type II diabetes mellitus
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal05010  Alzheimer disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05034  Alcoholism
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110311382 (Mapk1)
   04012 ErbB signaling pathway
    110311382 (Mapk1)
   04014 Ras signaling pathway
    110311382 (Mapk1)
   04015 Rap1 signaling pathway
    110311382 (Mapk1)
   04350 TGF-beta signaling pathway
    110311382 (Mapk1)
   04370 VEGF signaling pathway
    110311382 (Mapk1)
   04371 Apelin signaling pathway
    110311382 (Mapk1)
   04668 TNF signaling pathway
    110311382 (Mapk1)
   04066 HIF-1 signaling pathway
    110311382 (Mapk1)
   04068 FoxO signaling pathway
    110311382 (Mapk1)
   04072 Phospholipase D signaling pathway
    110311382 (Mapk1)
   04071 Sphingolipid signaling pathway
    110311382 (Mapk1)
   04024 cAMP signaling pathway
    110311382 (Mapk1)
   04022 cGMP-PKG signaling pathway
    110311382 (Mapk1)
   04151 PI3K-Akt signaling pathway
    110311382 (Mapk1)
   04150 mTOR signaling pathway
    110311382 (Mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110311382 (Mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110311382 (Mapk1)
   04210 Apoptosis
    110311382 (Mapk1)
   04218 Cellular senescence
    110311382 (Mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110311382 (Mapk1)
   04520 Adherens junction
    110311382 (Mapk1)
   04540 Gap junction
    110311382 (Mapk1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110311382 (Mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110311382 (Mapk1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110311382 (Mapk1)
   04613 Neutrophil extracellular trap formation
    110311382 (Mapk1)
   04620 Toll-like receptor signaling pathway
    110311382 (Mapk1)
   04621 NOD-like receptor signaling pathway
    110311382 (Mapk1)
   04625 C-type lectin receptor signaling pathway
    110311382 (Mapk1)
   04650 Natural killer cell mediated cytotoxicity
    110311382 (Mapk1)
   04660 T cell receptor signaling pathway
    110311382 (Mapk1)
   04658 Th1 and Th2 cell differentiation
    110311382 (Mapk1)
   04659 Th17 cell differentiation
    110311382 (Mapk1)
   04657 IL-17 signaling pathway
    110311382 (Mapk1)
   04662 B cell receptor signaling pathway
    110311382 (Mapk1)
   04664 Fc epsilon RI signaling pathway
    110311382 (Mapk1)
   04666 Fc gamma R-mediated phagocytosis
    110311382 (Mapk1)
   04062 Chemokine signaling pathway
    110311382 (Mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110311382 (Mapk1)
   04929 GnRH secretion
    110311382 (Mapk1)
   04912 GnRH signaling pathway
    110311382 (Mapk1)
   04915 Estrogen signaling pathway
    110311382 (Mapk1)
   04914 Progesterone-mediated oocyte maturation
    110311382 (Mapk1)
   04917 Prolactin signaling pathway
    110311382 (Mapk1)
   04921 Oxytocin signaling pathway
    110311382 (Mapk1)
   04926 Relaxin signaling pathway
    110311382 (Mapk1)
   04935 Growth hormone synthesis, secretion and action
    110311382 (Mapk1)
   04919 Thyroid hormone signaling pathway
    110311382 (Mapk1)
   04928 Parathyroid hormone synthesis, secretion and action
    110311382 (Mapk1)
   04916 Melanogenesis
    110311382 (Mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110311382 (Mapk1)
   04270 Vascular smooth muscle contraction
    110311382 (Mapk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110311382 (Mapk1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110311382 (Mapk1)
   04725 Cholinergic synapse
    110311382 (Mapk1)
   04726 Serotonergic synapse
    110311382 (Mapk1)
   04720 Long-term potentiation
    110311382 (Mapk1)
   04730 Long-term depression
    110311382 (Mapk1)
   04723 Retrograde endocannabinoid signaling
    110311382 (Mapk1)
   04722 Neurotrophin signaling pathway
    110311382 (Mapk1)
  09158 Development and regeneration
   04360 Axon guidance
    110311382 (Mapk1)
   04380 Osteoclast differentiation
    110311382 (Mapk1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110311382 (Mapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311382 (Mapk1)
   05206 MicroRNAs in cancer
    110311382 (Mapk1)
   05205 Proteoglycans in cancer
    110311382 (Mapk1)
   05203 Viral carcinogenesis
    110311382 (Mapk1)
   05230 Central carbon metabolism in cancer
    110311382 (Mapk1)
   05231 Choline metabolism in cancer
    110311382 (Mapk1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110311382 (Mapk1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110311382 (Mapk1)
   05212 Pancreatic cancer
    110311382 (Mapk1)
   05225 Hepatocellular carcinoma
    110311382 (Mapk1)
   05226 Gastric cancer
    110311382 (Mapk1)
   05214 Glioma
    110311382 (Mapk1)
   05216 Thyroid cancer
    110311382 (Mapk1)
   05221 Acute myeloid leukemia
    110311382 (Mapk1)
   05220 Chronic myeloid leukemia
    110311382 (Mapk1)
   05218 Melanoma
    110311382 (Mapk1)
   05211 Renal cell carcinoma
    110311382 (Mapk1)
   05219 Bladder cancer
    110311382 (Mapk1)
   05215 Prostate cancer
    110311382 (Mapk1)
   05213 Endometrial cancer
    110311382 (Mapk1)
   05224 Breast cancer
    110311382 (Mapk1)
   05223 Non-small cell lung cancer
    110311382 (Mapk1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110311382 (Mapk1)
   05020 Prion disease
    110311382 (Mapk1)
   05022 Pathways of neurodegeneration - multiple diseases
    110311382 (Mapk1)
  09165 Substance dependence
   05034 Alcoholism
    110311382 (Mapk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110311382 (Mapk1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110311382 (Mapk1)
   04934 Cushing syndrome
    110311382 (Mapk1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110311382 (Mapk1)
   05135 Yersinia infection
    110311382 (Mapk1)
   05133 Pertussis
    110311382 (Mapk1)
   05152 Tuberculosis
    110311382 (Mapk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110311382 (Mapk1)
   05170 Human immunodeficiency virus 1 infection
    110311382 (Mapk1)
   05161 Hepatitis B
    110311382 (Mapk1)
   05160 Hepatitis C
    110311382 (Mapk1)
   05171 Coronavirus disease - COVID-19
    110311382 (Mapk1)
   05164 Influenza A
    110311382 (Mapk1)
   05163 Human cytomegalovirus infection
    110311382 (Mapk1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110311382 (Mapk1)
   05165 Human papillomavirus infection
    110311382 (Mapk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110311382 (Mapk1)
   05140 Leishmaniasis
    110311382 (Mapk1)
   05142 Chagas disease
    110311382 (Mapk1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110311382 (Mapk1)
   01524 Platinum drug resistance
    110311382 (Mapk1)
   01522 Endocrine resistance
    110311382 (Mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110311382 (Mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110311382 (Mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110311382 (Mapk1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110311382 (Mapk1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110311382 (Mapk1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     110311382 (Mapk1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110311382 (Mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 110311382
NCBI-ProteinID: XP_021040310
Ensembl: MGP_CAROLIEiJ_G0020501
UniProt: A0A6P5R8X8
LinkDB
Position
16
AA seq 358 aa
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcggcggcagcggcggcgggcccggagatggtccgcgggcaggtgttcgacgtgggg
ccgcgctacaccaacctctcgtacatcggtgaaggcgcctacggcatggtttgctctgct
tatgataatctcaacaaagttcgagttgctatcaagaaaatcagtccttttgagcaccaa
acctactgtcaaagaaccctaagagagataaaaatcttactgcgcttcagacatgagaac
atcatcggcatcaatgacatcatccgggcaccaaccattgagcaaatgaaagatgtatat
atagtacaggacctcatggagacagatctttacaagctcttgaagacacagcacctcagc
aatgaccatatctgctattttctctatcagatcctgagaggattaaaatatatccattca
gctaatgttctgcaccgtgacctcaagccttccaacctcctgctgaacaccacgtgtgat
ctcaagatctgtgactttggccttgcccgtgttgcagatccagatcatgatcacacgggg
ttcttgacagagtacgtagccacacgttggtacagagctccagaaattatgttgaattcc
aagggttataccaagtccattgatatttggtctgtgggctgcatcctggcagagatgcta
tccaacaggcctatcttcccaggaaagcattaccttgaccagctgaatcacatcctgggt
attcttggatctccatcacaagaagatctgaattgtataataaatttaaaagctagaaac
tatttgctttctcttccgcacaaaaataaggtgccatggaacaggttgttcccaaatgct
gactccaaagctctggatttactggataaaatgttgacatttaaccctcacaagaggatt
gaagttgaacaggctctggcccacccatacctggagcagtattatgacccaagtgatgag
cccattgctgaagcgccattcaagtttgacatggagttggacgacttacctaaggagaag
ctcaaagaactcatttttgaagagactgctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system