KEGG   Mus caroli (Ryukyu mouse): 110297901
Entry
110297901         CDS       T05910                                 

Gene name
Abcc8
Definition
(RefSeq) ATP-binding cassette sub-family C member 8 isoform X1
  KO
K05032  ATP-binding cassette subfamily C (CFTR/MRP) member 8
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal02010  ABC transporters
mcal04911  Insulin secretion
mcal04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    110297901 (Abcc8)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110297901 (Abcc8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110297901 (Abcc8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110297901 (Abcc8)
Transporters [BR:mcal02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC8, 9 subgroups
    110297901 (Abcc8)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MTABC_N AAA_29 ATPase AAA_25 RsgA_GTPase ABC_ATPase Zeta_toxin
Other DBs
NCBI-GeneID: 110297901
NCBI-ProteinID: XP_021022643
Ensembl: MGP_CAROLIEiJ_G0029757
UniProt: A0A6P5Q221
LinkDB
Position
7
AA seq 1588 aa
MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHI
HHSTWLHFPGHNLRWILTFMLLFVLVCEIAEGVLSDGVTESRHLHLYMPAGMAFMAAITS
VVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDHAIGFSQLRFCLTGLLVILYG
MLLLVEINVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HRKPIDLRAIGKLPIAMRALTNYQRLCAAFDAQARKDTQSQQGARAIWRALCHAFGRRLV
LSSTFRILADLLGFAGPLCIFGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAV
LLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNL
VAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFCSRVEMTRRKEMTSLRAFAVYT
SISIFMNTAIPIAAVLITFVGHVSFFRESDFSPSVAFASLSLFHILVTPLFLLSSVVRST
VKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQAVPLKVVNRKRPAREEVRDLL
GPLQRLTPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQRVSGAVFWNSSLPDSEGEDPRYCLRTSNPERETAADSDARSRGPVAYAS
QKPWLLNATVEENITFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQ
RQRISVARALYQHTNVVFLDDPFSALDVHLSDHLMQAGILELLRDDKRTVVLVTHKLQYL
PHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKAPEPSQ
GLPRAMSSRDGLLLDEDEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGVLLLS
LLVFSQLLKHMVLVAIDYWLAKWTDSALVLSPAAKNCSLSQECALDQSVYAMVFTVLCSL
GIALCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCNTIDQ
HIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDD
TTQLPLLSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEY
IGACVVLIAAATSISNSLHRELSAGLVGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKR
IHTLLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPVLKHVNALIAPGQK
IGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSG
TIRFNLDPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLAR
AFVRKTSIFIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVMVLKR
GAILEFDKPEKLLSQKDSVFASFVRADK
NT seq 4767 nt   +upstreamnt  +downstreamnt
atgcccttggccttctgcggtaccgagaaccactcggccgcctaccgggtggaccaaggt
gtcctcaacaacggctgcttcgtggacgcgctcaacgtggtgccacatgtcttcctgctc
ttcatcactttccccatcctcttcatcggatggggcagccagagctccaaggtgcacatt
caccacagcacctggctccatttccccggccacaacctgcgctggatccttaccttcatg
ctgctctttgtcctggtgtgtgagattgctgagggcgtcctgtctgacggggtgacagaa
tcccgccacctccatttgtacatgccagctgggatggctttcatggctgccatcacctct
gtggtctactatcacaacattgagacctctaacttccccaagctgctgattgctctgctt
atctactggaccttggccttcatcactaagaccatcaagttcgtcaagttctatgaccat
gccatcggcttctctcagctgcgcttctgcctcacggggcttctggtgatcctctacggg
atgctgctgcttgtggagatcaatgtcatccgggtgcggagatacatcttcttcaagacg
ccaagggaagtgaagcctcccgaggacctgcaggacctgggggtgcgctttctgcagccc
ttcgtgaacctgctatcaaaggggacctactggtggatgaatgccttcatcaagactgcc
cacaggaagcccatcgacctgcgggccatcgggaagctgcccatagccatgagagccctc
accaactatcagcgactctgcgcggccttcgatgcccaggcgcggaaagacacgcagagc
cagcagggcgcccgggccatctggagggctctctgccatgcctttgggagacgcctggtc
ctcagcagcacattccgtatcctggctgacctgttgggctttgctggaccgctctgcatc
tttgggatcgtggaccacctcgggaaggagaaccatgtcttccagcccaagacacagttt
cttggggtttactttgtctcgtcccaagagttcctgggcaatgcctatgtcttggctgtg
cttctgttcctggccctcctgctgcaaaggacattcctgcaagcctcatactacgtcgcc
attgaaactgggattaacctgagaggggcgatccagaccaagatttacaacaagatcatg
cacttgtctacttctaacctgtcaatgggggagatgacggctgggcagatctgcaacctg
gtggccatcgacacaaaccagctcatgtggtttttcttcttatgcccaaacctctgggct
atgccagtacagatcattgtgggcgtgatcctcctctactacatccttggggtcagcgcc
ttgattggagcagctgtcatcattctgctggctcctgtacagtactttgtggccaccaag
ctctcccaggcacagcggagcaccctggaatattccaatgagaggctgaagcagaccaac
gagatgctccggggcatcaaactgctcaaactatacgcgtgggagaacatcttctgctcg
agggtggagatgacacgcaggaaggaaatgacgagcctcagggccttcgccgtctacacc
tccatctccatcttcatgaacacagctatccccattgctgccgtcctcattaccttcgtg
ggccacgtcagcttcttcagagagtcagacttctcaccctcggtggcctttgcctctctc
tctctcttccacatcctggtcacaccgctgttcctgctgtctagtgtggttcggtccacc
gtcaaggccctagtgagtgtgcaaaagctgagtgagttcctgtccagtgcagagatccgt
gaggaacagtgcgccccccgagagcctgcaccccaaggccaagcgggcaagtaccaggcg
gtgcccctcaaggtcgtgaaccgtaagcgcccggcccgggaagaggttcgggacctcttg
ggcccactgcagaggctgacccccagcatggatggagatgctgacaacttctgtgtccag
atcatcggaggcttcttcacctggacccctgatggaatccccaccctgtccaacattacc
atccgtatcccccgaggccagctgaccatgattgtggggcaggtgggctgcggcaagtcc
tcgctccttctggccaccctgggggagatgcagagggtctccggggccgtcttctggaac
agcagccttccagacagcgagggagaagaccccaggtactgcctcaggacaagcaaccca
gagcgggagacagcagccgactcggatgccaggagcagaggccccgtagcctacgcatct
cagaaaccgtggctgctaaatgccacggtggaggagaacatcaccttcgagagtcccttc
aataagcaacggtacaagatggtcatagaagcctgctccctgcagccagacatagacatc
ttgccccatggagaccagactcagattggggaacggggcatcaacttgtctggtggtcag
cgtcagcgaatcagtgtagcccgtgccctctaccagcacaccaatgttgtcttcttggat
gaccccttctcagctctggatgtccatctgagtgaccacctgatgcaggccggcatcctt
gagctgctccgggatgacaagaggacagtggtcttggtgacccacaagctacagtacctg
cctcatgcagactggatcattgctatgaaggatggcaccattcagagagaggggacactc
aaggacttccagaggtctgagtgccagctctttgagcattggaagaccctcatgaacagg
caagaccaagagttggagaaggagacagtcatggagagaaaagccccagaaccgtctcag
ggcctgccccgtgccatgtcctcaagagacggccttctgctggatgaggacgaggaggaa
gaggaggcagccgagagcgaggaagatgacaacttatcttcggtgctgcatcagcgagcc
aagatcccatggcgggcctgcactaagtatttgtcctctgccggcgtcctgctcctgtcc
ctgcttgtcttctcccagctactcaagcacatggtcttggtggccatcgattactggctg
gccaagtggacggacagtgccctggtcctgagccctgccgccaagaactgctccctcagc
caggaatgcgccctggaccagtctgtctatgccatggtattcaccgtgctctgcagcctg
ggaattgcactgtgccttgtcacctctgtcactgtggagtggacaggactgaaggtggcc
aagaggctgcaccgcagcctgctcaatcgcatcatcctggcccccatgaggttctttgag
accacacccctggggagtatcctgaacagattttcatctgactgtaacaccattgaccag
cacatcccatccacgctggagtgtctgagccgatccactctactctgtgtctctgccttg
actgtcatctcctacgtcacaccggtgttcctcgtggccctcttacccctagctgtggtg
tgctacttcatccagaaatacttccgagtggcgtccagggacctgcagcagctggatgac
acaacgcagctccctctgctctcacactttgctgaaaccgtggaaggactcaccaccatc
cgtgccttcaggtatgaggcccggttccagcagaagctcctggagtacacggactccaac
aacatcgcctccctcttcctcacggcagccaacaggtggctagaagtccgcatggagtac
attggagcatgtgtggtactcatcgcagccgccacctccatctccaactccctgcacagg
gagctctctgctggcctggtgggcctgggcctcacctacgccttgatggtctccaactac
ctcaactggatggtgaggaacctggcagacatggagatccaattgggggctgtgaagcgc
atccatacactcctgaaaactgaggcagagagctatgaggggctcctagcaccgtcattg
atccccaagaactggccagaccaagggaagattcaaattcaaaacctgagtgtgcgctat
gacagctccctgaagcccgtgctgaagcacgtcaatgccctcatcgccccaggacagaag
attgggatctgcggccgcacaggcagtgggaagtcctccttctctctcgcctttttccga
atggtggacatgttcgaagggcgcatcatcattgatggcatcgacatcgccaagctgccg
ctgcacacgctccgttcacgcctgtccatcatcctacaggaccctgtcctcttcagcggc
accatcagattcaacctggacccagagaagaaatgctcagacagcacactctgggaggct
ctggagatcgcccagctgaagctggtggtgaaggcgctgccaggaggcctggatgccatc
atcacagaaggaggggagaattttagtcaaggccagaggcagctattctgcctggctcgg
gccttcgtgagaaagaccagcatcttcatcatggacgaagcaactgcctccattgacatg
gctacggaaaacatcctccagaaggtggtgatgacagcctttgcagaccgcaccgtggtc
accatcgcgcaccgtgtgcacaccatcctgagtgcagacctcgtgatggtcctgaagagg
ggagccatcctggagtttgacaaaccggagaagcttctgagccagaaggacagcgtcttc
gcctcctttgtccgcgcggacaaatga

DBGET integrated database retrieval system