KEGG   Mus caroli (Ryukyu mouse): 110297909
Entry
110297909         CDS       T05910                                 

Gene name
Bbc3
Definition
(RefSeq) bcl-2-binding component 3 isoform X1
  KO
K10132  Bcl-2-binding component 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04390  Hippo signaling pathway
mcal05016  Huntington disease
mcal05162  Measles
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110297909 (Bbc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110297909 (Bbc3)
   04215 Apoptosis - multiple species
    110297909 (Bbc3)
   04115 p53 signaling pathway
    110297909 (Bbc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297909 (Bbc3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110297909 (Bbc3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110297909 (Bbc3)
  09172 Infectious disease: viral
   05162 Measles
    110297909 (Bbc3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110297909 (Bbc3)
SSDB
Motif
Pfam: PUMA
Other DBs
NCBI-GeneID: 110297909
NCBI-ProteinID: XP_021022663
Ensembl: MGP_CAROLIEiJ_G0029231
UniProt: A0A6P5PV88
LinkDB
Position
7
AA seq 209 aa
MLAFVTRRGVCAPGSAMARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGL
PAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHL
ESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHR
PSPWRVMYNLFMGLLPLPRDPGAPEMEPN
NT seq 630 nt   +upstreamnt  +downstreamnt
atgttggcgtttgtcacccggaggggtgtctgcgctccagggagcgccatggcccgcgca
cgccaggagggcagctctccggagcccgtagagggtctagcccgcgacagtccgcgcccc
ttcccgctcggccgcctgatgccctccgctgtatcctgcagcctttgcgagcccggcctg
cccgccgcccctgctgcccctgccttgctgccggccgcctacctctgcgcccccaccgct
ccacctgccgtcaccgccgccctggggggcccccgctggcctgggggtcaccgcagccgg
ccccgaggcccgcgcccggacggtcctcagccctcgctgtcaccagcccagcagcactta
gagtcgcccgtgcccagcgccccggaggccctggcgggaggccccacccaagctgccccg
ggagtgcgtgtggaggaggaggagtgggcccgggagatcggggcccagctgcggcggatg
gcggacgacctcaacgcgcagtacgagcggcggagacaagaagagcagcatcgacaccga
ccctcaccctggagggtcatgtacaatctcttcatgggactcctccccttacccagggat
cctggagccccagaaatggagcccaactag

DBGET integrated database retrieval system