KEGG   Mus caroli (Ryukyu mouse): 110297919
Entry
110297919         CDS       T05910                                 

Gene name
Bax
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04071  Sphingolipid signaling pathway
mcal04115  p53 signaling pathway
mcal04141  Protein processing in endoplasmic reticulum
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04722  Neurotrophin signaling pathway
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110297919 (Bax)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    110297919 (Bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110297919 (Bax)
   04215 Apoptosis - multiple species
    110297919 (Bax)
   04217 Necroptosis
    110297919 (Bax)
   04115 p53 signaling pathway
    110297919 (Bax)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110297919 (Bax)
  09149 Aging
   04211 Longevity regulating pathway
    110297919 (Bax)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110297919 (Bax)
   05202 Transcriptional misregulation in cancer
    110297919 (Bax)
   05203 Viral carcinogenesis
    110297919 (Bax)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110297919 (Bax)
   05212 Pancreatic cancer
    110297919 (Bax)
   05225 Hepatocellular carcinoma
    110297919 (Bax)
   05226 Gastric cancer
    110297919 (Bax)
   05214 Glioma
    110297919 (Bax)
   05216 Thyroid cancer
    110297919 (Bax)
   05220 Chronic myeloid leukemia
    110297919 (Bax)
   05217 Basal cell carcinoma
    110297919 (Bax)
   05218 Melanoma
    110297919 (Bax)
   05213 Endometrial cancer
    110297919 (Bax)
   05224 Breast cancer
    110297919 (Bax)
   05222 Small cell lung cancer
    110297919 (Bax)
   05223 Non-small cell lung cancer
    110297919 (Bax)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110297919 (Bax)
   05014 Amyotrophic lateral sclerosis
    110297919 (Bax)
   05016 Huntington disease
    110297919 (Bax)
   05020 Prion disease
    110297919 (Bax)
   05022 Pathways of neurodegeneration - multiple diseases
    110297919 (Bax)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110297919 (Bax)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110297919 (Bax)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110297919 (Bax)
   05152 Tuberculosis
    110297919 (Bax)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110297919 (Bax)
   05170 Human immunodeficiency virus 1 infection
    110297919 (Bax)
   05161 Hepatitis B
    110297919 (Bax)
   05160 Hepatitis C
    110297919 (Bax)
   05164 Influenza A
    110297919 (Bax)
   05162 Measles
    110297919 (Bax)
   05168 Herpes simplex virus 1 infection
    110297919 (Bax)
   05163 Human cytomegalovirus infection
    110297919 (Bax)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110297919 (Bax)
   05169 Epstein-Barr virus infection
    110297919 (Bax)
   05165 Human papillomavirus infection
    110297919 (Bax)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110297919 (Bax)
   01524 Platinum drug resistance
    110297919 (Bax)
   01522 Endocrine resistance
    110297919 (Bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110297919 (Bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110297919 (Bax)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    110297919 (Bax)
Transporters [BR:mcal02000]
 Other transporters
  Pores ion channels [TC:1]
   110297919 (Bax)
SSDB
Motif
Pfam: Bcl-2 CF222 Bclx_interact
Other DBs
NCBI-GeneID: 110297919
NCBI-ProteinID: XP_021022681
Ensembl: MGP_CAROLIEiJ_G0029721
UniProt: A0A6P5Q731
LinkDB
Position
7
AA seq 192 aa
MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLS
ECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagctcgggagcggcgggcccaccagctctgaacagatcatg
aagacaggggcctttttgctacagggtttcatccaggatcgagcaggaaggatggctggg
gagacacctgagctgaccttggagcagccgccccaggatgcgtccaccaagaagctgagc
gaatgtctccggcgaattggagatgaactggacagcaatatggagctgcagaggatgatt
gctgacgtggacacggactccccccgagaggtcttcttccgggtggcagctgacatgttt
gctgatggcaactttaactggggccgcgtggttgcccttttctactttgctagcaaactg
gtgctcaaggccctgtgcactaaagtgcccgagctgatcagaaccatcatgggctggaca
ctggacttcctccgtgagcggctgcttgtctggatccaagaccagggtggctgggaagga
ctcctctcctacttcgggacccccacatggcagaccgtgaccatctttgtggctggagtc
ctcaccgcctcgctcactatctggaagaagatgggctga

DBGET integrated database retrieval system