KEGG   Mus caroli (Ryukyu mouse): 110297922
Entry
110297922         CDS       T05910                                 

Gene name
Irf7
Definition
(RefSeq) interferon regulatory factor 7 isoform X1
  KO
K09447  interferon regulatory factor 7
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05164  Influenza A
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110297922 (Irf7)
   04621 NOD-like receptor signaling pathway
    110297922 (Irf7)
   04622 RIG-I-like receptor signaling pathway
    110297922 (Irf7)
   04623 Cytosolic DNA-sensing pathway
    110297922 (Irf7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110297922 (Irf7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110297922 (Irf7)
   05160 Hepatitis C
    110297922 (Irf7)
   05164 Influenza A
    110297922 (Irf7)
   05162 Measles
    110297922 (Irf7)
   05168 Herpes simplex virus 1 infection
    110297922 (Irf7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110297922 (Irf7)
   05169 Epstein-Barr virus infection
    110297922 (Irf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110297922 (Irf7)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    110297922 (Irf7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 110297922
NCBI-ProteinID: XP_021022685
Ensembl: MGP_CAROLIEiJ_G0030686
UniProt: A0A6P5PVA0
LinkDB
Position
7
AA seq 457 aa
MAEVRGVQRVLFGDWLLGEVSSGQYEGLQWLNEARTVFRIPWRHFGRRDLDEADAQIFKA
WAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALHSTGRFILRQDNSGDPVDPHK
VYELSPELGSAVGPATENREEVTLSNALPTQGVSPGSFLARENAGLQTPSSLLSSDAGDL
LLQVLQYSHIQESKSGADSVPPQAPGQEQERVYEEPYAAWQVEAVPSPRPQQPALTERNL
GFLDVTIMYKGRTVLQAMVWHPRCVFLYSPMAPAVRTSEPQPVIFPSPAELPDQKQLHYT
ETLLQHVSPGLQLELRGPSLWALRMGKCKVYWEVGSPMGTTDPSTPPQLLERNCHTPIFD
FSTFFRELEEFRARRRQGSPHYTIYLGFGQDLSAGRPKEKSLILVKLEPWVCKAHLEGVQ
REGVSSLDSSSLGLCLSSTNSLYEDIEHFLMDLGQWP
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggctgaagtgaggggggtccagcgagtgctgtttggagactggctattgggtgaggtc
agtagcggccagtacgaggggctgcagtggctgaacgaggctcgcacagtcttccgtata
ccctggaggcatttcggtcgtagggatctggatgaagcagatgcacagatcttcaaggcc
tgggctgtggcccgagggaggtggccacctagtggagttaacctgccacccccagaggct
gaggctgctgagcgaagagagcgaagaggctggaagaccaacttccgctgtgcactccac
agcacagggcgttttatcttgcgccaagacaattcaggggatccggttgatccgcacaag
gtgtacgaacttagcccggagcttgggtctgctgtgggcccagccacggaaaacagggaa
gaagtgaccctcagcaatgctctgcccacacagggtgtgtccccaggatcatttctggca
agagaaaatgctgggctccaaaccccaagctctctgctttctagtgatgctggggacctc
ttgcttcaggttctgcagtacagccacatacaggaatccaagtctggggcagactccgtc
ccaccacaggctcctggccaggagcaagaacgcgtttacgaggaaccctatgcagcatgg
caggtggaagctgtacccagtcccaggcctcaacagccagctctcaccgagcgcaacctt
gggttcctggatgtgaccatcatgtacaagggccgcacagtgctacaggcaatggtgtgg
caccccagatgcgtgttcctgtacagccccatggccccagcagtaagaacttcagagccc
cagccggtgatttttcccagtcctgctgagctcccagatcagaagcagctgcactacact
gagacgcttctacagcatgtgtctcctggccttcagctggagcttcggggaccatccctg
tgggccctgcgtatgggcaagtgcaaggtgtactgggaggtaggcagccctatgggcact
accgacccctccaccccaccccaactgctggagcgcaactgccacacccccatcttcgac
ttcagcactttcttccgagaactggaggagttccgggctcggaggcggcaaggatcacca
cactacaccatctacctgggttttgggcaagacttgtcagcagggaggcccaaggagaag
agcctgatcttggtgaagctggagccatgggtatgcaaggcacacctggagggcgtgcag
cgtgagggtgtgtcctccctggacagcagcagtctcggcctgtgcttgtctagcaccaac
agtctctacgaagacattgaacatttcctcatggacctgggtcagtggccttga

DBGET integrated database retrieval system