KEGG   Mus caroli (Ryukyu mouse): 110298102
Entry
110298102         CDS       T05910                                 

Gene name
Kif7
Definition
(RefSeq) kinesin-like protein KIF7 isoform X1
  KO
K18806  kinesin family member 7
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04340  Hedgehog signaling pathway
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110298102 (Kif7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298102 (Kif7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110298102 (Kif7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcal04812]
    110298102 (Kif7)
Cytoskeleton proteins [BR:mcal04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110298102 (Kif7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 110298102
NCBI-ProteinID: XP_021022772
Ensembl: MGP_CAROLIEiJ_G0029883
UniProt: A0A6P5PZV7
LinkDB
Position
7
AA seq 1349 aa
MGLEAQRLSGAEEAPVRVALRVRPLLPKELLHGHQSCLRVEPERGRITLGRDRHFGFHVV
LGEDTGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLHEDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLELYKEEFRDLLEVGTASRDIQLREDDRGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHFNRLSSRSHTVFTVTLEQRGRTPSRLPRPAA
GHLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSTLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWRPE
AERVPEEQAAGARGPPRHRSETRIIHRGRRVPCPAVGSAAVAAGLGAECARCRARTSAAY
SLLRELQAEPGLPGAAARKVRDWLCAVEGERSALSSASGPDSGIESAPAEDQAAQGTSGR
KGDEGAQQLLTLQSQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELRLRLEL
AQPGWGAPGLLQGLPLGSFVPRPHTAPLGGAHTHMLGMMPLTCLPGEEVSSEQQVVNGKE
VKAEVLAQADKLGNASSTTSEEEGEEEEEEEEEEEEEPPRRTLYLRRNGISNWSQRAGVR
PGSPPDRKGPEVCSEEPAAAIPAPQAVGSGKVPVQTRQAPAAMASEWRLAQAQQKIRELA
INIRMKEELIGELVRTGKAAQALNRQHSQRIRELEQEAERVRAELCEGQRQLRELEGREP
QDASERSRLQEFRKRVAAAQSQVQVLKEKKQATERLVSLSAQSETRLQELERNVQLMRRQ
QGQLQRRLREETEQKRRLETEMNKRQHRVKELELKHEQQQKILKIKTEEIAAFQRKRRSG
SNGSVVSLEQQQKIEEQKKWLDQEMEKVLQQRRALEELGEELRKREVILAKKEALMQEKT
GLESKRLRSSQALNEDIVRVSSRLEHLEKELSEKSGQLRQGSAQNQQQIRGEIDTLRQEK
DSLLKQRLEIDSKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASA
SLLSQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRL
VYWLEVALERQRLEMDRQLTLQQKEHEQNVQLLLQQGRDHLGEGLADSKRQYEARIHALE
KELGRHMWINQELKQKLSAGSTAGQSRGCERRSLCLENRQGLGNEDGLHPAAPEPLWQSS
LLEGVSRVWDESRDLVHAPLPLTWKRSSLCSEQGSSEESRVRETTEPPVGRVLPMGEVGL
SWNFGPLSKPRWEPRRTSPGMIDVRKNPL
NT seq 4050 nt   +upstreamnt  +downstreamnt
atggggctggaggcccagaggctgtctggggctgaggaggcccccgtgagggtggccctt
cgagttcgcccattgctgcccaaggagctgctgcatggtcatcagagttgcctgcgtgtg
gagcctgagcggggtcgaatcaccctggggcgtgaccgccactttgggttccatgtggtc
ctgggagaggacactgggcaagaggctgtgtaccaggcttgcgtgcagcccctcctcgag
gctttctttgagggcttcaatgccaccgtctttgcctatggtcagacaggctctgggaag
acatataccatgggggaggccagtgtggcctccctgcatgaagatgaacaaggtatcatc
ccaagggccatggctgaggccttcaagctcattgatgagaatgacctgctggactgcctg
gtgcatgtatcctacctggaactctacaaggaagagttccgagatctgctagaagtgggc
actgccagccgggacatccagcttcgggaagatgatcggggaaatgttgtgctctgtggg
gtgaaagaagtggacgtagaaggcctggacgaggtgctgagcctcctagagatgggcaac
gctgcgcgccacacaggcgccacacacttcaaccgcctctccagccgctcacacacagtc
ttcactgtgaccctggagcagcggggacggactcctagccgtttgcctcgacccgccgct
ggccacctgctggtctccaaattccacttcgtggacctggcaggctccgagagggttctg
aagactggcagcaccggagaacggctcaaagagagcatccaaattaacagcaccctgctg
gcgctgggaaatgtcattagcgctctgggggacccccagcgccgaggcagccacatccct
taccgtgactccaagatcacccggatcctcaaagactctctgggagggaatgccaagaca
gtgatgatcgcctgcgtcagcccctcctcctccgacttcgatgagaccctcaacacccta
aactacgccagccgtgctcagaacatccgcaatcgcgccacagtcaattggcgtccagag
gccgagcgcgtccctgaggaacaggcggcgggtgcgcgcgggccgccgcgacaccgctcg
gaaacgcgcatcatccatcgcggccggcgcgtgccctgccctgcagtgggctccgcggca
gtcgctgcgggcctgggggccgaatgcgcgcgctgccgggcccgcaccagcgccgcctac
agcctcctgcgagagctgcaggccgagcccgggctgcctggcgctgccgcccgcaaagtg
cgggactggctgtgcgcggtggagggcgagcgcagcgccttgagctctgcctccggaccc
gacagcggcatcgaaagcgctccagccgaggaccaggcggcacaggggaccagtgggaga
aagggagatgagggggcccagcagctgttgaccctgcagagccaggtggcccggctagag
gaggagaatcgagacttcctggcggctttggaggacgccatggagcagtacaaactgcag
agtgaccgtctgcgggagcagcaggaagagatggtggaactgcggctacgcctagagctg
gcacaacctggctggggcgcaccggggctcctgcagggcttgccactgggatcctttgtg
ccccggcctcacacagcccccctggggggtgcccacactcacatgctgggcatgatgccc
ctgacatgtcttcctggagaagaagttagctctgagcagcaggtggtgaatggcaaggaa
gtcaaagcagaggtgttggcccaggcggacaaactggggaatgcctcttccactacatca
gaggaggaaggggaggaggaggaggaggaagaagaggaagaagaagaggagccacctagg
cggaccttatacttgcgcagaaatgggatcagcaactggagtcagagggcaggggtgcgt
ccagggagcccacctgacaggaagggcccagaggtctgctcagaagagccagctgctgcc
atcccagcaccacaagcagttggtagtggcaaggtcccagttcagacccgccaggcccca
gctgccatggcctctgagtggcgactggcccaggcccaacagaaaatccgggaactggcc
atcaacatccgcatgaaggaggagctcattggtgagctggtccggacagggaaggcggcc
caggccctgaaccgtcagcacagccagcgcatccgggagctggagcaggaggctgagcgt
gtgcgggcggagctgtgtgaagggcagaggcagcttcgagagctagagggcagggagccc
caagatgccagcgagaggtccaggctccaggaattccgtaagagagtggctgcagcccaa
agccaggtgcaggtgctgaaggagaagaagcaggcaacagagcgactggtgtcactgtcg
gctcaaagtgaaactcggctacaggagctggagaggaatgtgcagctcatgcggcgacag
caggggcagctgcagaggcggctccgtgaggagacagagcagaagcggcgccttgagacg
gagatgaacaagcggcagcatcgcgtcaaggagctggagctgaagcacgagcaacagcaa
aagatcctgaaaatcaagacagaagagatcgcagccttccagaggaagaggcgcagtggc
agcaatggctctgtggtgagcctggagcagcagcagaagatcgaggagcaaaagaagtgg
ctggaccaggagatggaaaaggtgttgcagcagcggcgggcgctggaggagttgggagag
gagctccgaaagcgggaggtcatcctggccaagaaggaggccctgatgcaggagaagacg
gggctcgagagcaagcgcctgaggtccagccaggccctaaatgaagacattgtgcgtgtg
tccagccgcctagaacacctggagaaggagctatctgagaagagtgggcagctgcggcaa
ggcagcgcccagaaccagcagcagatcagaggggagatagacacccttcgccaggagaag
gactcactgttgaagcagcgcctggagattgatagcaagctgaggcagggaagcctgctg
tcacctgaggaggagaggacactgttccagctggatgaagccatcgaggccctggacgct
gccatcgagtacaagaatgaggctatcacatgccgccagcgggtgctgcgggcttcggcc
tccttgctgtcccagtgtgagatgaatctcatggcaaagctcagctacctttcctcctca
gagaccagagccctgctgtgcaagtattttgacaaggtggtgacactccgagaggagcaa
caccagcaacagattgccttctcggagctggagatgcagctggaggagcagcagcggctg
gtgtactggctggaggtggccctggagcggcagcgcctggagatggaccggcagctgacc
ctgcagcagaaggagcacgagcagaatgtacagctgctcctccagcagggccgagaccac
cttggtgaggggttagcagacagcaagaggcaatatgaggcccggattcatgctctggag
aaggaactaggtcgacacatgtggataaaccaggagctgaagcagaagctcagtgcagga
agcaccgcaggccagagccggggttgtgagaggagaagcctctgcctggaaaacagacaa
ggccttggaaatgaagatgggctccatcctgcagctcctgaacctctctggcagtcctcc
cttctggagggggtgtcccgtgtgtgggatgagtcccgggacttggtccatgccccacta
cccctgacatggaaacgctcaagcttgtgcagcgagcagggctcctctgaggagtctagg
gtccgggagacaactgaacccccagtagggcgggtactacctatgggtgaagtgggcctc
tcctggaactttggacccttgtccaagccccggtgggaaccccgaagaaccagcccaggg
atgatcgacgtcaggaaaaaccccttgtag

DBGET integrated database retrieval system