KEGG   Mus caroli (Ryukyu mouse): 110298189
Entry
110298189         CDS       T05910                                 

Gene name
Ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04218  Cellular senescence
mcal04310  Wnt signaling pathway
mcal04340  Hedgehog signaling pathway
mcal04371  Apelin signaling pathway
mcal04390  Hippo signaling pathway
mcal04510  Focal adhesion
mcal04530  Tight junction
mcal04630  JAK-STAT signaling pathway
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04934  Cushing syndrome
mcal05160  Hepatitis C
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110298189 (Ccnd1)
   04340 Hedgehog signaling pathway
    110298189 (Ccnd1)
   04390 Hippo signaling pathway
    110298189 (Ccnd1)
   04371 Apelin signaling pathway
    110298189 (Ccnd1)
   04630 JAK-STAT signaling pathway
    110298189 (Ccnd1)
   04068 FoxO signaling pathway
    110298189 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    110298189 (Ccnd1)
   04152 AMPK signaling pathway
    110298189 (Ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110298189 (Ccnd1)
   04115 p53 signaling pathway
    110298189 (Ccnd1)
   04218 Cellular senescence
    110298189 (Ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110298189 (Ccnd1)
   04530 Tight junction
    110298189 (Ccnd1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110298189 (Ccnd1)
   04921 Oxytocin signaling pathway
    110298189 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    110298189 (Ccnd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298189 (Ccnd1)
   05206 MicroRNAs in cancer
    110298189 (Ccnd1)
   05205 Proteoglycans in cancer
    110298189 (Ccnd1)
   05203 Viral carcinogenesis
    110298189 (Ccnd1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110298189 (Ccnd1)
   05212 Pancreatic cancer
    110298189 (Ccnd1)
   05225 Hepatocellular carcinoma
    110298189 (Ccnd1)
   05226 Gastric cancer
    110298189 (Ccnd1)
   05214 Glioma
    110298189 (Ccnd1)
   05216 Thyroid cancer
    110298189 (Ccnd1)
   05221 Acute myeloid leukemia
    110298189 (Ccnd1)
   05220 Chronic myeloid leukemia
    110298189 (Ccnd1)
   05218 Melanoma
    110298189 (Ccnd1)
   05219 Bladder cancer
    110298189 (Ccnd1)
   05215 Prostate cancer
    110298189 (Ccnd1)
   05213 Endometrial cancer
    110298189 (Ccnd1)
   05224 Breast cancer
    110298189 (Ccnd1)
   05222 Small cell lung cancer
    110298189 (Ccnd1)
   05223 Non-small cell lung cancer
    110298189 (Ccnd1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110298189 (Ccnd1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110298189 (Ccnd1)
   04934 Cushing syndrome
    110298189 (Ccnd1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110298189 (Ccnd1)
   05162 Measles
    110298189 (Ccnd1)
   05160 Hepatitis C
    110298189 (Ccnd1)
   05163 Human cytomegalovirus infection
    110298189 (Ccnd1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110298189 (Ccnd1)
   05169 Epstein-Barr virus infection
    110298189 (Ccnd1)
   05165 Human papillomavirus infection
    110298189 (Ccnd1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110298189 (Ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110298189
NCBI-ProteinID: XP_021022922
Ensembl: MGP_CAROLIEiJ_G0030761
LinkDB
Position
7
AA seq 310 aa
MEHQLLCCEVDTIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCD
PVSKSHQRRLQLARAWEPWWAVPRHCVTGLELRGAKSGSPRASSQSHGSQRHRGLWCCDS
APAMCMGSGM
NT seq 933 nt   +upstreamnt  +downstreamnt
atggaacaccagctcttgtgctgcgaagtggataccatccgccgcgcgtaccctgacacc
aatctcctcaacgaccgggtgcttcgagccatgctcaagacggaggagacctgtgcgccc
tccgtatcttacttcaagtgcgtgcagaaggagattgtgccatccatgcggaaaatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaagaggaggtcttcccgctg
gccatgaactacctggaccgattcctgtccctggagcccctgaagaagagccgcctacag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaggagaccattcccctgact
gccgagaagttgtgcatctacactgacaactctatccggcccgaggagctgctgcaaatg
gaactgctgctggtgaacaagctcaagtggaacctggccgccatgactccccacgatttc
atcgaacacttcctctccaaaatgccagaggcggatgagaacaagcagaccatccgcaag
catgcacagacctttgtggccctctgtgccacagatgtgaagttcatttccaacccaccc
tccatggtagctgctgggagcgtggtggctgcgatgcaaggcctgaacctgggcagcccc
aacaacttcctctcctgctaccgcacaacgcactttctttccagagtcatcaagtgtgac
ccggtgagtaagtctcatcaaaggagactacagctggcaagggcctgggaaccttggtgg
gcagtgccaaggcactgtgtgactgggctggagctgagaggtgccaaatctgggtcccca
cgagcctcttcccagagtcatgggtcccaaaggcatagagggctgtggtgttgtgacagt
gcccctgcaatgtgtatgggtagtggcatgtga

DBGET integrated database retrieval system