KEGG   Mus caroli (Ryukyu mouse): 110298322
Entry
110298322         CDS       T05910                                 

Gene name
Irf3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110298322 (Irf3)
   04621 NOD-like receptor signaling pathway
    110298322 (Irf3)
   04622 RIG-I-like receptor signaling pathway
    110298322 (Irf3)
   04623 Cytosolic DNA-sensing pathway
    110298322 (Irf3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110298322 (Irf3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110298322 (Irf3)
   05133 Pertussis
    110298322 (Irf3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110298322 (Irf3)
   05161 Hepatitis B
    110298322 (Irf3)
   05160 Hepatitis C
    110298322 (Irf3)
   05171 Coronavirus disease - COVID-19
    110298322 (Irf3)
   05164 Influenza A
    110298322 (Irf3)
   05162 Measles
    110298322 (Irf3)
   05168 Herpes simplex virus 1 infection
    110298322 (Irf3)
   05163 Human cytomegalovirus infection
    110298322 (Irf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110298322 (Irf3)
   05169 Epstein-Barr virus infection
    110298322 (Irf3)
   05165 Human papillomavirus infection
    110298322 (Irf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110298322 (Irf3)
   04131 Membrane trafficking [BR:mcal04131]
    110298322 (Irf3)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    110298322 (Irf3)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    110298322 (Irf3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 110298322
NCBI-ProteinID: XP_021023153
Ensembl: MGP_CAROLIEiJ_G0029689
UniProt: A0A6P5PW79
LinkDB
Position
7
AA seq 419 aa
MGTPKPLILPWLVSQLDLGQLEGVAWLDESRTKFRIPWKHGLRQDAQMADFGIFQAWAEA
SGAYTPGKDKPDLSTWKRNFRSALNRKEVLRLAVDNSKDPYDPHKVYEFVTPGARDFVHL
GASPDTNGRSSLPHSQENLPELLDCLVLGPLTDEGSSDLAIVSDPSQRLPSPDVNNFLNP
TPQENPLKQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTADMTLPWQPVTLPD
PEGFLTDKLAREYVGHVIKGLGNGLALWRAGQCLWAQRLGHSHAFWALGEELLPDSGRGP
DGEVHKDKDGAVFDLRPFVADLIAFMEGSGHSPRYTLWFCVGEMWPQDQPWVKRLVMVKV
VPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQYKAYLQDLVEDMDFQATGGI
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgggaaccccgaaaccgctgattttgccctggttggtgtcacaactggacctggggcag
ctggaaggcgtggcctggctggacgagagccgaacgaagttcaggatcccgtggaagcat
ggcctacggcaggacgcacagatggctgactttggcatcttccaggcctgggcagaagcc
agtggtgcctacaccccggggaaggataagccagacctgtcaacctggaagaggaatttc
cggtcagccctgaaccgcaaagaagtgttgcggttagctgttgacaatagcaaggaccct
tatgaccctcataaagtgtatgagtttgtgactccaggtgcgagggacttcgtacatctg
ggtgcctctcctgacaccaatggcagaagcagcctgcctcactcccaggaaaacctaccg
gagttacttgattgcctggtcttggggcccctcacagatgaggggtcctcagatctggct
attgtttctgatccttctcaacgactgccaagccccgatgtgaacaacttcctaaatccc
acaccccaagaaaatccactgaagcagctgctagctgaggaacaatgggagttcgaggtg
accgccttctaccgaggccgccaggtcttccagcagacactcttttgcccggggggcctg
cggctggtgggcagcacagctgacatgacactgccctggcagccagtcaccctgcccgat
cctgaggggtttctgacggacaagcttgcgagggagtatgtggggcacgtgatcaaaggg
ctgggcaacgggctggcactgtggcgggcggggcagtgcctctgggcccagcgcctaggc
cactcccacgccttctgggctctgggggaggagctgcttccagacagtggtcgagggcct
gatggagaggtccacaaggacaaggacggagccgtgttcgacctcaggcccttcgtggca
gatctgattgccttcatggaaggaagtggacactccccacgctacactctgtggttctgc
gtgggagaaatgtggccccaggaccagccgtgggtcaagaggcttgtgatggtcaaggtt
gttcctacatgtcttaaggagctgttagagatggcccgggaagggggagcctcttcactg
aaaacagtggacttgcacatctccaacagccagcctatatcccttacctctgaccagtac
aaggcctacctccaggacttggtggaggacatggacttccaggccactggaggtatctga

DBGET integrated database retrieval system