KEGG   Mus caroli (Ryukyu mouse): 110298992
Entry
110298992         CDS       T05910                                 

Gene name
Kcnj11
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 11 isoform X1
  KO
K05004  potassium inwardly-rectifying channel subfamily J member 11
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04911  Insulin secretion
mcal04929  GnRH secretion
mcal04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110298992 (Kcnj11)
   04929 GnRH secretion
    110298992 (Kcnj11)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110298992 (Kcnj11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110298992 (Kcnj11)
Ion channels [BR:mcal04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   110298992 (Kcnj11)
SSDB
Motif
Pfam: IRK_C IRK EI24 Ion_trans_2
Other DBs
NCBI-GeneID: 110298992
NCBI-ProteinID: XP_021024209
Ensembl: MGP_CAROLIEiJ_G0029756
UniProt: A0A6P5Q624
LinkDB
Position
7
AA seq 390 aa
MLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALT
LASSRGPLRKRSVAVAKAKPKFSISPDSLS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgctgtcccgaaagggcattatccctgaggaatatgtgctgacccggctggcagaggac
cctgcagagcccaggtaccgtactcgagagaggagggctcgtttcgtgtccaagaaaggc
aactgcaacgtcgcccacaagaacattcgagagcagggccgcttcctgcaggatgtgttc
accacgctggtggacctcaaatggccgcacactctgctcattttcaccatgtccttcctg
tgcagttggctgctcttcgccatggtctggtggctcatcgccttcgcccacggtgacctg
gcccccggagagggcaccaatgtgccctgcgtcacaagcatccactccttttcatctgcc
ttccttttctccatcgaggtccaggtgaccattggtttcggcgggcgcatggtgacagag
gaatgtcccctggccatcctcattctcattgtgcagaatattgtagggctgatgatcaac
gccatcatgctgggctgcatcttcatgaaaacggcccaggcccatcggcgcgcagaaacc
ctcatcttcagcaagcatgctgtgatcgccctgcgccatggccgcctgtgcttcatgctg
cgcgtaggggacctccgaaagagcatgatcattagcgccaccatccacatgcaggtggtg
cgcaagaccaccagtcccgagggcgaagttgtgcctctccaccaggtggacatccccatg
gagaatggcgtgggtggtaacagcatcttcctggtggccccactcatcatctaccacgtc
atcgactccaacagcccgctctacgacctggctcctagtgacctgcaccaccaccaggac
ctggagatcattgtcatcttggaaggcgtggtagaaaccacgggcatcaccacccaggcc
cgtacctcctacctagctgacgagattctatgggggcagcgctttgtccccattgtggcc
gaggaggacggccgctattctgtggactactccaaatttggtaacaccgttaaagtgccc
acaccactctgcacagcccgccagcttgatgaggaccgcagtctgctggatgccctgacc
ctcgcctcgtcgcgggggcccctgcgcaagcgcagtgtggctgtggcgaaggccaagccc
aagtttagcatctctccggattccttgtcctga

DBGET integrated database retrieval system