KEGG   Mus caroli (Ryukyu mouse): 110299462
Entry
110299462         CDS       T05910                                 

Gene name
Egln2
Definition
(RefSeq) egl nine homolog 2
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04066  HIF-1 signaling pathway
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110299462 (Egln2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299462 (Egln2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110299462 (Egln2)
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     110299462 (Egln2)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Other DBs
NCBI-GeneID: 110299462
NCBI-ProteinID: XP_021024823
Ensembl: MGP_CAROLIEiJ_G0029398
UniProt: A0A6P5Q7G7
LinkDB
Position
7
AA seq 418 aa
MDSPCQPQALNQALPKLPGSVSESLESSRARMGVESYLPCPLLPAYHRPGASGEASAGNG
TPRSTATATTTTASPLREGFGGQDGGELWPLQSEGAAALVTKECQRLAAQGARPEAPKRK
WAKDGGDAPSPSKRPWARQENQEAKGESGMGCDSGASNSSSNSNTTNSSGEASARLREEV
QPSAPERLALDYIVPCMRYYGICVKDNFLGAVLGGRVLAEVEALKWGGRLRDGQLVSQRA
IPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGNYVINGRTKAMVACYPG
NGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLI
FWSDRRNPHEVKPAYATRYAITVWYFDAKERAAARDKYQLASGQKGVQVPVSQPTTPT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggacagcccgtgccagccgcaggccctgaatcaagctctccctaagttgccagggtct
gtgtcagagtccttggagtctagccgagccagaatgggggtggagagttacctgccctgc
cctctgctcccggcctatcaccgtccaggagcatctggggaggcctcggctggcaatggg
acccccagaagcacagccactgctactacgaccactgccagtcccctgcgggagggcttt
ggtgggcaggatggtggtgagctttggccactgcagagtgaaggtgctgctgcgttggtc
accaaggagtgccagcgactggcggcccagggtgcccggcctgaggcccccaaacggaag
tgggccaaggatggtggggatgccccttcacccagcaagagaccgtgggccagacaagag
aaccaggaggccaagggggaaagtggtatgggctgtgacagcggtgccagcaacagcagc
agcaacagcaacactaccaatagcagtggcgaggcaagtgctaggttgagggaggaagtc
cagccatctgcacctgagcgcctggccctggactatattgtgccttgcatgcggtactat
ggtatctgtgtcaaggacaacttcttgggggcagtactgggtggccgtgtgctggctgag
gtggaagccctgaagtggggcgggcgtctccgtgatgggcaactagtgagccagcgggcg
atcccaccgcgcagcattcgtggggaccagattgcctgggtagaaggtcacgagccaggc
tgccgaagcattggtgccctcatggctcacgtggacgcagtaatccgccactgtgcaggg
cggctgggcaactacgtcatcaatgggcgcaccaaggccatggtggcgtgttatccaggc
aatgggctcgggtacgtgaggcatgttgacaatccccacggcgatgggcgctgcatcacc
tgtatctattacctgaatcagaactgggatgttaaggtgcatggcggcctgctgcagatc
ttccccgagggtcggccagtggtagccaacatcgagccactctttgaccggttgctcatt
ttctggtctgaccgacggaacccacatgaggtgaagccagcctatgccaccaggtacgcc
atcactgtctggtattttgatgccaaggaacgggcagcagccagagacaagtatcagcta
gcatcgggacagaaaggtgtccaagtaccagtatcacagccaactacacctacctaa

KEGG   Mus caroli (Ryukyu mouse): 110300648
Entry
110300648         CDS       T05910                                 

Gene name
Egln1
Definition
(RefSeq) egl nine homolog 1
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04066  HIF-1 signaling pathway
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110300648 (Egln1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300648 (Egln1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110300648 (Egln1)
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     110300648 (Egln1)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 zf-MYND 2OG-FeII_Oxy_4 zf-Mss51
Other DBs
NCBI-GeneID: 110300648
NCBI-ProteinID: XP_021026564
Ensembl: MGP_CAROLIEiJ_G0031717
UniProt: A0A6P5QB95
LinkDB
Position
8
AA seq 400 aa
MASDSGGSGVLSASERDRQYCELCGKMENLLRCGRCRSSFYCCKEHQRQDWKKHKLVCQG
GEAPRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSAAASRVPGPEDAAQARSGPGPAE
PGSEDPPLSRSPGPERASLCPAGGGPGETLSPGGGLRPNGQTKPLPALKLALEYIVPCMN
KHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDQITWIEGKE
PGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRC
VTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATR
YAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggccagtgacagcggcgggtccggcgtgctgagcgccagcgagcgcgaccggcagtac
tgcgagctgtgcgggaagatggagaacctgctgcgctgcggccgctgccgcagctccttc
tactgctgcaaagagcaccagcgccaggactggaagaagcacaagctggtgtgccagggc
ggcgaggccccccgcgcgcagcccgcgccggcgcagccccgcgtcgcgcccccgcccggt
ggggcccccggagccgcgcgcgccggcggggcggcccggcgcggggacagcgcggcggcc
tcgcgcgtaccgggcccggaggacgcggcgcaggcccggagcggccccggcccagccgag
cccggctccgaggatcctccgcttagccggtctcccggccccgagcgcgccagcctgtgc
ccagcgggtggcggccccggggagacgctgagtcccggcggagggctgcggcccaacggg
cagaccaagccgctgcccgcgttgaagctggctctggagtacatcgtgccgtgcatgaac
aagcacggcatctgcgtggtggacgacttcctgggcagggagaccgggcagcagatcggc
gacgaggtgcgcgccctgcacgacaccggcaagttcacggacgggcagctggtcagccag
aagagtgactcttccaaggacatccggggggaccagatcacctggatcgagggcaaagag
cccggctgcgaaaccatcggcctgctcatgagcagcatggacgacctgatccgccactgc
agcgggaagctgggcaactacaggataaacggccgaacgaaagccatggttgcttgttac
ccaggcaatggaacaggctatgtccgtcacgttgataacccaaatggagatggaagatgc
gtgacatgtatatattatctaaataaagactgggacgccaaggtaagtggaggtatcctt
cgaatttttccagaaggcaaagcccagtttgctgacattgaacccaaatttgatagactg
ctgtttttctggtctgaccggcgtaaccctcatgaagtacagccagcatacgccacaagg
tacgcaataactgtttggtattttgatgcagatgagcgagcgagagctaaagtaaaatat
ctaacaggtgagaaaggtgtgagggttgaactcaagcccaattcagtcagcaaagacgtc
tag

KEGG   Mus caroli (Ryukyu mouse): 110307114
Entry
110307114         CDS       T05910                                 

Gene name
Egln3
Definition
(RefSeq) egl nine homolog 3 isoform X1
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04066  HIF-1 signaling pathway
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110307114 (Egln3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110307114 (Egln3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110307114 (Egln3)
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     110307114 (Egln3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4
Other DBs
NCBI-GeneID: 110307114
NCBI-ProteinID: XP_021035020
UniProt: A0A6P5QZY3
LinkDB
Position
12
AA seq 355 aa
MTLGSRRGFLSFLPRPRPPRRWLCISKRGPPTSHWASPALGGGALRCSRRSQSRAPFSSE
FRATFPASGAKVARGLWPPQVGEPRARLSASLLCARTGQALGACTLGIPGLGSVGEMPLG
HIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQLAGP
RAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLYCGSRLGKYYVKERSKAMVAC
YPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFVADVEPIFDR
LLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAKD
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgacgttggggtcaaggcggggctttctctcgttcctcccccggccacggccgccgcgg
cggtggctctgcatctccaaaaggggccctccgacttctcactgggccagtccggcgctg
ggtggcggagccctacgctgctctcgccggtctcagagccgggctcccttctcttcagag
tttcgagcaactttccccgcctctggagctaaagtggctcggggactgtggccaccgcag
gtgggagagccccgggcccggctctccgcatctttgctgtgcgctcgcactgggcaagcc
ctgggtgcgtgcaccctggggatccccggcctcggctctgtgggcgagatgcctctggga
cacatcatgaggctggatctggagaagatcgccctggagtacatcgtgccctgtctgcac
gaggtcggcttctgctacctggacaacttcctaggcgaggtggtgggcgactgcgtgctg
gagcgagtcaagcagctgcactacaacggggccctgcgtgacggccagctggcggggccg
cgcgccggcgtctccaagaggcacctgcgaggcgaccagatcacgtggatcgggggcaac
gaggagggctgcgaggccatcaacttcctcctgtccctcatcgaccggctggtcctgtac
tgcgggagccggctgggcaaatactatgtcaaggagcggtccaaggcaatggtggcttgc
tatccaggaaatggaacaggttatgttcgccatgtggacaaccccaatggtgatggccgc
tgtatcacctgtatctactacctgaataagaattgggacgccaagttacacggaggggtc
ctgcggatatttccggaagggaaatcgtttgtagcagacgtggagcccatctttgataga
cttctgttcttctggtcagaccgcaggaatccacatgaagtccagccctcctacgccacc
aggtacgctatgactgtctggtacttcgatgctgaagaaagggcagaagccaaaaagaaa
ttcaggaatttaactagaaaaactgaatctgcccttgctaaagactga

DBGET integrated database retrieval system