KEGG   Mus caroli (Ryukyu mouse): 110299550
Entry
110299550         CDS       T05910                                 

Gene name
Fgfr1
Definition
(RefSeq) fibroblast growth factor receptor 1 isoform X1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04520  Adherens junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04714  Thermogenesis
mcal04810  Regulation of actin cytoskeleton
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05224  Breast cancer
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110299550 (Fgfr1)
   04014 Ras signaling pathway
    110299550 (Fgfr1)
   04015 Rap1 signaling pathway
    110299550 (Fgfr1)
   04020 Calcium signaling pathway
    110299550 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    110299550 (Fgfr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110299550 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110299550 (Fgfr1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110299550 (Fgfr1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110299550 (Fgfr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110299550 (Fgfr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299550 (Fgfr1)
   05205 Proteoglycans in cancer
    110299550 (Fgfr1)
   05230 Central carbon metabolism in cancer
    110299550 (Fgfr1)
  09162 Cancer: specific types
   05218 Melanoma
    110299550 (Fgfr1)
   05215 Prostate cancer
    110299550 (Fgfr1)
   05224 Breast cancer
    110299550 (Fgfr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110299550 (Fgfr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110299550 (Fgfr1)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110299550 (Fgfr1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110299550 (Fgfr1)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   110299550 (Fgfr1)
CD molecules [BR:mcal04090]
 Proteins
  110299550 (Fgfr1)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110299550 (Fgfr1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_4 Ig_6 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 110299550
NCBI-ProteinID: XP_021024914
Ensembl: MGP_CAROLIEiJ_G0030923
UniProt: A0A6P5Q569
LinkDB
Position
8
AA seq 820 aa
MWGWKCLLFWAVLVTAALCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgtggggctggaagtgcctgctcttctgggctgtgctggtcacagccgctctctgcact
gccaggccagccccaaccttgcccgaacaagctcagccctggggagtccctgtggaagtg
gagtctctcctggtccaccctggcgacctgctacagcttcgctgtcggcttcgcgatgat
gtgcagagcatcaactggctgcgggatggggtgcagctggtggagagcaaccgtacccgc
atcacaggggaggaggtggaggtgcgggactccatccctgctgactctggcctctacgct
tgcgtgaccagcagcccctctggcagcgataccacctacttctccgtcaatgtctcagat
gcactcccatcgtcggaagatgatgacgacgacgatgactcctcctcggaggagaaagag
acggacaacaccaaaccaaaccgtaggcctgtagctccctactggacatccccagagaaa
atggagaagaaactgcacgcggtgcccgctgccaagacggtgaagttcaagtgcccgtcg
agtgggacacccaaccccactctgcgctggttgaaaaatggcaaagagttcaagcctgac
caccgaattggaggctacaaggttcgctatgccacctggagcatcataatggattctgtg
gtgccttctgacaagggcaactacacctgcatcgtggagaatgagtatgggagcatcaac
cacacctaccagcttgatgttgtggaacgatctccgcaccgacccatccttcaggcaggg
ctgcctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agcgatccgcagcctcacattcagtggctgaagcacatcgaggtgaacgggagtaagatc
gggccagacaacttgccgtatgtccagatcctgaagactgctggagttaataccaccgac
aaggaaatggaggtgcttcatctacggaatgtctcctttgaggatgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagagaccagccgtgatgacctcaccgctctacctggagatcattatctac
tgcaccggggccttcctgatctcctgtatgttgggctctgtcatcatctataagatgaag
agcggcaccaagaagagcgacttccatagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtgtcagctgactccagtgcatccatgaactctggggttctc
ctggttcggccctcacggctctcctccagcgggacccccatgctggctggagtctcggaa
tatgagctccccgaggatccccgctgggagctgccacgagacagactggtcttaggcaaa
ccacttggcgagggctgcttcgggcaggtggtgttggctgaggccatcgggctggataaa
gacaaacccaaccgcgtgaccaaagtggccgtgaagatgttgaagtccgacgcaacggag
aaggacctgtcagatctgatctcggagatggagatgatgaaaatgatcgggaagcacaag
aatatcatcaaccttctgggggcatgcacacaggatggtcctctttatgtcattgtggag
tatgcctccaaaggcaatctccgggagtatctacaggcccggaggcctccggggctggag
tactgctacaaccccagccacaaccccgaggaacagctgtcttccaaagatctggtatcc
tgtgcctatcaggtggctcggggcatggagtatcttgcctctaagaagtgtatacaccga
gacctggctgctaggaacgtcctggtgaccgaggataacgtaatgaagatcgcagacttt
ggcttagctcgagacattcaccatatcgactactacaagaaaaccaccaacggccggctg
cctgtgaagtggatggcccctgaggcattgtttgaccggatctacacccaccagagcgat
gtgtggtcttttggagtgctcctgtgggagatcttcactctgggtggctccccatatcct
ggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcatcgaatggacaagccc
agtaactgtaccaatgagctgtacatgatgatgcgggactgctggcatgcagtgccctct
cagagacctacgttcaagcagttggtggaagacctggaccgcattgtggccttgacctcc
aaccaggagtatctggacctgtccataccgctggaccagtactcacccagctttcccgac
acacggagctccacctgctcctcaggggaggactctgtcttctctcatgagcctttacct
gaggagccctgtctgcctcgacaccccacccagcttgccaacagtggactcaaacggcgc
tga

DBGET integrated database retrieval system