KEGG   Mus caroli (Ryukyu mouse): 110299617
Entry
110299617         CDS       T05910                                 

Gene name
Jak3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04062  Chemokine signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04630  JAK-STAT signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal05161  Hepatitis B
mcal05162  Measles
mcal05166  Human T-cell leukemia virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05223  Non-small cell lung cancer
mcal05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110299617 (Jak3)
   04151 PI3K-Akt signaling pathway
    110299617 (Jak3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110299617 (Jak3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110299617 (Jak3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110299617 (Jak3)
   04659 Th17 cell differentiation
    110299617 (Jak3)
   04062 Chemokine signaling pathway
    110299617 (Jak3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299617 (Jak3)
   05203 Viral carcinogenesis
    110299617 (Jak3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110299617 (Jak3)
  09163 Immune disease
   05340 Primary immunodeficiency
    110299617 (Jak3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110299617 (Jak3)
   05161 Hepatitis B
    110299617 (Jak3)
   05162 Measles
    110299617 (Jak3)
   05169 Epstein-Barr virus infection
    110299617 (Jak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110299617 (Jak3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110299617 (Jak3)
Protein kinases [BR:mcal01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   110299617 (Jak3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl APH Kdo pKID
Other DBs
NCBI-GeneID: 110299617
NCBI-ProteinID: XP_021025003
Ensembl: MGP_CAROLIEiJ_G0031199
UniProt: A0A6P5Q7V6
LinkDB
Position
8
AA seq 1100 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKA
CGILPVYHSLFALATEDFSCWFPPSHIFCIEDVDTQVLVYRLRFYFPDWFGLETCHRFGL
RKDLTSAILDLHVLEHLFAQHRSDLVSGRLPVGLSMKEQGEFLSLAVLDLAQMAREQAQR
PGELLKMVSYKACLPPSLRDVIQGQNFLTRRRIRRTVVLALRRVVACQADRYALMAKYIL
DLERLHPAATTETFRVGLPGAQEEPGLLRVAGDNGIAWSSGDQELFQTFCDFPEIVDVSI
KQAPRVGPAGEHRLVTVTRMDGHILEAEFPGLPEALSFVALVDGYFRLICDSRHYFCKEV
APPRLLEEEEELCHGPITLDFAIHKLKAAGSLPGTYILRRSPQDYDSFLLTACVQTPLGP
DYKGCLIRQDPSGAFSLVGLSQPHRSLRELLAACWHSGLRVDGAALNLTSCCAPRPKEKS
NLIVVRRGCTPAPAPGCSPSCCALTQLSFHTIPVDSLEWHENLGHGSFTKIFHGRRREVV
DGETHDSEVLLKVMDSRHRNCMESFLEAASLMSQVSYPHLVLLHGVCMAGDSIMVQEFVY
LGAIDMYLRKRGHLVSASWKLQVTKQLAYALNYLEDKGLPHGNVSARKVLLAREGGDGNP
PFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEAQTLGLEADKWGFGATTWEVFSGGPA
HITSLEPAKKLKFYEDQGQLPALKWTELAGLITQCMAYDPGRRPSFRAILRDLNGLITSD
YELLSDPTPGIPSSRDELCGGAQLYACQDPAIFEERHLKYISLLGKGNFGSVELCRYDPL
GDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEY
LPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVK
IADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYC
DKSCSPSAEFLRMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPQD
RPAFGTLSPQLDALWHGRPG
NT seq 3303 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacacctctgatccctcagcgctcttgcagcctctcatcc
tcagaggcaggagccctgcatgtgctccttcctccccggggacctgggcctccccagcga
ctgtcattctcttttggggactacttggccgaggatctgtgtgtgcgagctgccaaggcc
tgtggcatcctgcctgtttatcattcgcttttcgctctggccactgaggacttctcttgc
tggtttcccccaagccacatcttctgcatagaggacgtggacactcaagtcttggtctac
aggctacgcttttatttccctgactggtttgggctggagacatgtcaccgctttgggctg
cgcaaagatttgaccagtgccatccttgacttacatgttttagaacatctctttgctcag
caccgcagtgacctggtgagtgggcgcctcccggtgggccttagcatgaaggaacaggga
gagttcctgagcctggccgtgctggacttggcccagatggctcgtgagcaggcccagcgc
ccaggagagctgctgaagatggtcagttacaaagcctgtctgccgcccagcctgcgcgat
gtgatccagggccagaacttcttgacacgcaggcgcatccgcaggaccgtggtcctggcg
ctgcgccgcgtggtcgcctgccaggccgaccgctacgcgctcatggccaagtatattctg
gacctggagcggctacatccagcggccaccaccgagaccttccgtgtggggctcccgggc
gcccaggaggagccggggcttctgcgtgtggcgggggacaacggcatcgcctggagctcc
ggggaccaggagcttttccagaccttctgtgactttccggaaatcgtggatgtcagcatc
aagcaggccccacgtgtgggtccggcaggggagcaccggctggtcaccgtcaccaggatg
gacggccacatcctggaagcagagtttccggggctgcctgaggcgctgtccttcgtggcc
ctcgtggatgggtacttccgcctgatctgcgactccaggcattatttctgcaaggaggtg
gcgccgccgcggctgctggaggaggaggaggagctgtgccatggacccatcacgttagac
tttgccatccacaagctgaaggccgctggctccctcccaggcacctacattctccgccgt
agcccgcaggactatgacagctttcttcttaccgcctgtgtccagactcctcttggcccc
gactacaagggctgcctcatccgccaggaccccagtggggctttctccctggttggtctc
agccagccgcacagaagcctgcgggagctgcttgcagcctgctggcattccgggcttcga
gtagatggcgctgccctgaacctaacatcctgctgcgctcccagacccaaggaaaagtcc
aatttgatcgtggtgcgaaggggctgcactccagcgcctgcccctggctgctccccgtcc
tgctgtgcactgacacagctgagcttccacacgattccagtggacagcctggagtggcac
gagaacctgggtcacggttcttttaccaagatcttccatggccgcaggcgggaggtagtg
gatggtgagacacatgactcagaagtcctcctgaaggtcatggactccagacatcggaac
tgcatggagtcttttctggaagctgcaagcttgatgagccaagtatcctacccacacctg
gtgttactgcacggcgtctgcatggctggagacagcatcatggtgcaggaatttgtgtat
ctaggagcaattgacatgtacctgcgcaagcgtggccacctggtgtcagccagctggaaa
ctgcaggtgaccaagcagctggcatatgcccttaactacttggaggacaaaggccttcct
catggcaacgtctcagcacggaaggtgctcctggctcgcgaggggggtgatgggaatcca
cctttcattaagctgagtgatcctggtgtcagtcccactgtgctgagcctggaaatgctc
accgacagaataccctgggtggcccccgaatgtctccaggaggctcagacgctcggcttg
gaggctgacaagtggggctttggagccaccacgtgggaggtgttcagcgggggacccgcc
cacatcacctcgctggagcccgccaaaaagctgaagttctatgaggatcagggacagctg
cccgccctcaaatggacagaactggcgggacttatcacacagtgcatggcgtatgatcct
ggccggcgcccctccttccgagctatcctcagagacctcaacggcctcattacatcagat
tatgagctcctctcagaccccacacctggcatcccgagttcccgagatgagctgtgcggt
ggcgcccagctctatgcctgccaggaccccgccatattcgaggagagacaccttaagtac
atttctttgttgggcaagggtaactttggcagcgtggagctgtgccgctacgaccccctg
ggggacaatacaggacccctggtggcagtgaaacagctacagcacagcgggccagaccag
cagagggacttccagcgggagattcagatccttaaggctctgcacagcgacttcatcgtc
aagtaccggggagtcagctatgggccaggtcgccagagcctacggttggtgatggagtac
ctgcccagcggctgcctgcgggacttcctgcagcgccatcgcgcgcgcctgcacaccgac
cgcctactgctgttcgcctggcagatctgcaagggcatggagtacctgggtgcgcgccgc
tgcgtgcaccgtgacctggctgcgcgcaacatcctggtggagagcgaggcgcatgtgaag
atcgcggacttcggcctcgctaagctgctgcccctgggaaaggattactacgtggtccgc
gagcctggccaaagccccatcttttggtatgccccggagtccctatctgacaacatcttc
tcccgccaatctgacgtgtggagcttcggagtggtgttgtacgagctcttcacctactgc
gacaagagctgcagcccatctgctgagttcctgcgcatgatggggcctgagcgtgaagga
cccccgctctgccgcctcctggagctgctggcagagggccgacgcctcccaccacctccc
acctgccccaccgaggttcaggaactcatgcagctgtgctgggcgcccagcccgcaggac
cggccagccttcggcaccctgagcccccagctggacgcgctgtggcatggaagacccgga
tag

DBGET integrated database retrieval system