KEGG   Mus caroli (Ryukyu mouse): 110299719
Entry
110299719         CDS       T05910                                 

Gene name
Adcy7
Definition
(RefSeq) adenylate cyclase type 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04727  GABAergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05032  Morphine addiction
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110299719 (Adcy7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110299719 (Adcy7)
   04371 Apelin signaling pathway
    110299719 (Adcy7)
   04020 Calcium signaling pathway
    110299719 (Adcy7)
   04072 Phospholipase D signaling pathway
    110299719 (Adcy7)
   04024 cAMP signaling pathway
    110299719 (Adcy7)
   04022 cGMP-PKG signaling pathway
    110299719 (Adcy7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110299719 (Adcy7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110299719 (Adcy7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110299719 (Adcy7)
   04062 Chemokine signaling pathway
    110299719 (Adcy7)
  09152 Endocrine system
   04911 Insulin secretion
    110299719 (Adcy7)
   04923 Regulation of lipolysis in adipocytes
    110299719 (Adcy7)
   04912 GnRH signaling pathway
    110299719 (Adcy7)
   04913 Ovarian steroidogenesis
    110299719 (Adcy7)
   04915 Estrogen signaling pathway
    110299719 (Adcy7)
   04914 Progesterone-mediated oocyte maturation
    110299719 (Adcy7)
   04921 Oxytocin signaling pathway
    110299719 (Adcy7)
   04926 Relaxin signaling pathway
    110299719 (Adcy7)
   04935 Growth hormone synthesis, secretion and action
    110299719 (Adcy7)
   04918 Thyroid hormone synthesis
    110299719 (Adcy7)
   04928 Parathyroid hormone synthesis, secretion and action
    110299719 (Adcy7)
   04916 Melanogenesis
    110299719 (Adcy7)
   04925 Aldosterone synthesis and secretion
    110299719 (Adcy7)
   04927 Cortisol synthesis and secretion
    110299719 (Adcy7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110299719 (Adcy7)
   04270 Vascular smooth muscle contraction
    110299719 (Adcy7)
  09154 Digestive system
   04970 Salivary secretion
    110299719 (Adcy7)
   04971 Gastric acid secretion
    110299719 (Adcy7)
   04972 Pancreatic secretion
    110299719 (Adcy7)
   04976 Bile secretion
    110299719 (Adcy7)
  09156 Nervous system
   04724 Glutamatergic synapse
    110299719 (Adcy7)
   04727 GABAergic synapse
    110299719 (Adcy7)
   04725 Cholinergic synapse
    110299719 (Adcy7)
   04723 Retrograde endocannabinoid signaling
    110299719 (Adcy7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110299719 (Adcy7)
  09149 Aging
   04211 Longevity regulating pathway
    110299719 (Adcy7)
   04213 Longevity regulating pathway - multiple species
    110299719 (Adcy7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110299719 (Adcy7)
   04714 Thermogenesis
    110299719 (Adcy7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299719 (Adcy7)
  09165 Substance dependence
   05032 Morphine addiction
    110299719 (Adcy7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110299719 (Adcy7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110299719 (Adcy7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110299719 (Adcy7)
   05163 Human cytomegalovirus infection
    110299719 (Adcy7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110299719 (Adcy7)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110299719 (Adcy7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 110299719
NCBI-ProteinID: XP_021025161
Ensembl: MGP_CAROLIEiJ_G0031356
UniProt: A0A6P5Q5P7
LinkDB
Position
8
AA seq 1099 aa
MPAKGRYFLNEGDEGPDQAALYEKYRLTSLHGPLLLLLLLVAVATCIAFISIAFSHEDLR
RHQAVLGTAFLMLTLFVALYVLVYVECLVQRWLRALALLTWACLMVLGSVLMWDSLENEA
HAWEQVPFFLFVVFVVYALLPLSRRAAIVVGVTSTVSHLLVFGAVTRAFQMSMSSTQLGL
QLLANAVILLGGNFTGAFHKHQLQDASRDLFIYTVKCIQIRRKLRVEKRQQENLLLSVLP
AHISMGMKLAIIERLKEGGDRHYMPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPK
ELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAI
KQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITE
ATLNHLDKAYEVEDGHGEQRDPYLKEMNIRTYLVIDPRSQQPPPPSHHLSKPKGDATLKM
RASVRVTRYLESWGAARPFAHLNHRESVSSSETPISNGRRQKAIPLRRHRAPDRSASPKG
RLEDDCDDEMLSAIEGLSSTRPCCSKSDDFHTFGPIFLEKGFEREYRLVPIPRARYDFAC
ASLVFVCILLVHLLVMPRMATLGVSFGLVACLLGLVLSFCFATEFSRCFPSRSTLQAISE
SVETQPLVRLVLVVLTVGSLLTVAIINMPLTLNPGPEQPEDNKTSPLAAQNRVGTPCELL
PYYTCSCILGFIACSVFLRMSLELKAMLLTVALVAYLLLFNLSPCWHVSGNSTETNGTQR
TRLLLSDAQSMPSHTLAPGARETTPSPSYLERDLKIMVNFYLILFYATLILLSRQIDYYC
RLDCLWKKKFKKEHEEFETMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYDCVCVM
FASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAA
GLSAPSGHENQDLERKHVHIGVLVEFSMALMSKLDGINRHSFNSFRLRVGINHGPVIAGV
IGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGE
LRTYFVCTDTAKFQGLGLN
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctaaatgagggtgatgaaggacccgaccaggcagcg
ctctatgagaagtaccggctcaccagcctgcacgggccactactgctcttgctcctcctg
gtggccgtggccacctgcattgcgttcatcagcattgccttcagccatgaggatctccgc
agacaccaggctgtcctgggcactgcgttcctcatgctgacgctgtttgtggctctctat
gtgctggtgtatgtcgagtgcctggtgcagcggtggctgcgggccttggcgctactcacc
tgggcttgcctcatggtactaggctccgtgctgatgtgggactctttggagaatgaagcc
catgcgtgggagcaggtgcctttcttcctgttcgtcgtctttgtggtgtacgcactactg
cctctcagcaggagggcagccatcgtggtaggcgtgacctccacggtctcccatctcctg
gtgtttggagctgtgacaagagccttccagatgtccatgtctagcactcagctggggctg
cagctcctggccaatgccgttatcctcctgggtgggaacttcacgggtgccttccataag
caccagctgcaggacgcgtccagggatctctttatctacaccgtcaaatgcatccagatc
cgtcggaagcttcgtgtggagaagcgccagcaggagaacctgcttctttcagtgctccca
gcacacatctccatgggcatgaagctggccatcattgagcgcctcaaagagggtggtgac
cgacactacatgcccgacaacaactttcacagcctctatgtcaagcggcaccagaacgtc
agcatcttgtatgcagacatcgtgggcttcacgaggctggccagcgactgctctcccaag
gagctggtggtggtgctcaacgagctgtttgggaagtttgaccagattgctaaggccaat
gagtgcatgcggatcaagatcctgggtgactgttactactgcgtgtcaggcctgcctgtg
tcgttgcccacacatgcccgcaactgtgtgaagatgggtctggacatctgcgaggccatt
aagcaggtgcgtgaggccacgggcgtggacatcagtatgcgtgtgggcattcactccggg
aatgtgctatgtggggtcatcgggctccgtaagtggcagtatgatgtgtggtcccatgat
gtgtccctggccaacaggatggaggcagctggagtccctggccgggtgcacatcacagag
gcaacattgaatcacctggacaaggcgtatgaggtggaggatgggcatggggagcagcga
gacccctatctgaaagagatgaacatccgaacctacctggtgatcgatccccggagccag
cagccacccccacccagccaccacctctccaagcccaagggggatgctactctgaagatg
cgggcttcagtgcgtgtaacccgctatctggagtcttggggggcagcccggccctttgca
cacctcaaccaccgggagagtgtgagcagcagtgagacccccatctccaacggacggagg
cagaaggccattcctctgcgtcgacaccgtgcccctgataggagtgcatcccccaagggg
cgcttggaagatgactgtgatgacgagatgctgtcagccattgaggggctcagctccacc
aggccctgctgctccaagtctgatgacttccacacctttggtcccatcttcttggagaag
ggctttgagcgtgagtaccgcctggtgcccatcccccgggctcgctacgacttcgcctgt
gccagccttgtcttcgtctgcatcctgctcgtccaccttctagtgatgcccaggatggca
actctgggtgtgtcctttgggctggtggcctgcctgctggggctggttctgagtttctgc
tttgctactgagttctcgaggtgctttccatcccgaagtacactccaggccatctcggag
agcgtggagacgcaacccctggtcaggcttgtcctggttgtgctgactgttggcagccta
ctgactgttgccatcattaacatgccactgacgcttaacccaggcccagagcagcctgaa
gacaacaagacaagcccactggctgcacagaacagagttgggaccccatgtgagctcctc
ccgtactacacctgcagctgcatcctgggcttcattgcatgctctgttttcctgcggatg
agcctagagctgaaggccatgctgctgacagtggccttggtggcctacctgctgctcttc
aacctctccccatgctggcacgtctcaggcaatagcactgagaccaacgggacacaaagg
acacggctgctcctgtctgatgcacaaagcatgcccagccacacccttgctccgggggct
cgggagactaccccttcccccagttatttagagagagacctgaagatcatggtcaacttc
tacctgatcctgttctatgccaccctcatcttgctgtctagacagattgactactactgc
cgcttggactgtctgtggaagaagaagttcaagaaggagcacgaggagtttgaaacaatg
gagaatgtgaaccgcctcctcctggagaatgtgctgccggcgcacgtggctgcccacttc
attggggacaaggcagcagaggactggtaccatcagtcttatgactgtgtctgtgtcatg
tttgcatctgttccggacttcaaagtattctacactgagtgtgatgtcaacaaagaagga
ctggagtgccttcgactgctgaatgagatcattgctgattttgacgagctcctgctaaag
cccaagttcagtggtgtggagaagatcaagaccattggcagcacctacatggcagcagca
gggctcagtgccccctcaggacatgagaaccaggacctggagcggaagcacgtgcacatt
ggagtcttggtggaatttagcatggccctgatgagcaagctggatgggatcaacaggcac
tccttcaactccttccgcctccgagtcggcataaaccacgggcctgtgattgctggagtg
attggagcccgcaagcctcagtatgacatctggggaaacacagtcaatgttgccagccgc
atggagagcaccggagagcttgggaaaatccaggttaccgaagagacatgcactatcctc
cagggactaggatattcttgtgagtgccgtgggctaatcaacgtcaaaggcaaaggggaa
ctgcggacttactttgtatgtacagacactgccaagtttcaaggcctggggctaaactga

KEGG   Mus caroli (Ryukyu mouse): 110305998
Entry
110305998         CDS       T05910                                 

Gene name
Adcy1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04727  GABAergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05032  Morphine addiction
mcal05142  Chagas disease
mcal05146  Amoebiasis
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110305998 (Adcy1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110305998 (Adcy1)
   04371 Apelin signaling pathway
    110305998 (Adcy1)
   04020 Calcium signaling pathway
    110305998 (Adcy1)
   04072 Phospholipase D signaling pathway
    110305998 (Adcy1)
   04024 cAMP signaling pathway
    110305998 (Adcy1)
   04022 cGMP-PKG signaling pathway
    110305998 (Adcy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110305998 (Adcy1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110305998 (Adcy1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110305998 (Adcy1)
   04062 Chemokine signaling pathway
    110305998 (Adcy1)
  09152 Endocrine system
   04911 Insulin secretion
    110305998 (Adcy1)
   04923 Regulation of lipolysis in adipocytes
    110305998 (Adcy1)
   04912 GnRH signaling pathway
    110305998 (Adcy1)
   04913 Ovarian steroidogenesis
    110305998 (Adcy1)
   04915 Estrogen signaling pathway
    110305998 (Adcy1)
   04914 Progesterone-mediated oocyte maturation
    110305998 (Adcy1)
   04921 Oxytocin signaling pathway
    110305998 (Adcy1)
   04926 Relaxin signaling pathway
    110305998 (Adcy1)
   04935 Growth hormone synthesis, secretion and action
    110305998 (Adcy1)
   04918 Thyroid hormone synthesis
    110305998 (Adcy1)
   04928 Parathyroid hormone synthesis, secretion and action
    110305998 (Adcy1)
   04916 Melanogenesis
    110305998 (Adcy1)
   04925 Aldosterone synthesis and secretion
    110305998 (Adcy1)
   04927 Cortisol synthesis and secretion
    110305998 (Adcy1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110305998 (Adcy1)
   04270 Vascular smooth muscle contraction
    110305998 (Adcy1)
  09154 Digestive system
   04970 Salivary secretion
    110305998 (Adcy1)
   04971 Gastric acid secretion
    110305998 (Adcy1)
   04972 Pancreatic secretion
    110305998 (Adcy1)
   04976 Bile secretion
    110305998 (Adcy1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110305998 (Adcy1)
   04727 GABAergic synapse
    110305998 (Adcy1)
   04725 Cholinergic synapse
    110305998 (Adcy1)
   04720 Long-term potentiation
    110305998 (Adcy1)
   04723 Retrograde endocannabinoid signaling
    110305998 (Adcy1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110305998 (Adcy1)
  09149 Aging
   04211 Longevity regulating pathway
    110305998 (Adcy1)
   04213 Longevity regulating pathway - multiple species
    110305998 (Adcy1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110305998 (Adcy1)
   04714 Thermogenesis
    110305998 (Adcy1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305998 (Adcy1)
  09165 Substance dependence
   05032 Morphine addiction
    110305998 (Adcy1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110305998 (Adcy1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110305998 (Adcy1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110305998 (Adcy1)
   05163 Human cytomegalovirus infection
    110305998 (Adcy1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110305998 (Adcy1)
   05142 Chagas disease
    110305998 (Adcy1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110305998 (Adcy1)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110305998 (Adcy1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 110305998
NCBI-ProteinID: XP_021033846
Ensembl: MGP_CAROLIEiJ_G0016083
UniProt: A0A6P5QRR2
LinkDB
Position
11
AA seq 1118 aa
MAGAPRGQGGGGGAGEPGGAERAAGPGGRRGFRACGEEFACPELEALFRGYTLRLEQAAT
LKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCILFLALFVVTNVRSLQVSQLQQ
VGQLALFFSLTFALLCCPFALGGPARSSAGGAMGSTVAEQGVWQLLLVTFVSYALLPVRS
LLAIGFGLVVAASHLLVTAALVPAKRPRLWRTLGANALLFFGVNMYGVFVRILTERSQRK
AFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDN
VSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLT
QPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSN
DVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNTFLRTHKIETFFIVPSHR
RKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRT
ASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQKY
HQLQDEYFTSAVVLALILAALFGLIYLLVIPQSVAVLLLLVFSICFLVACTLYLHITRVQ
CFPGCLTIQIRTALCVFIVVLIYSVAQGCVVGCLPWAWSSQSNSSLVVLAAGGRRTVLPA
LPCESAHHALLCCLVGTLPLAIFLRVSSLPKMILLSGLTTSYILVLELSGYTKVGGGALS
GRSYEPIMAILLFSCTLALHARQVDVRLRLDYLWAAQAEEERDDMERVKLDNKRILFNLL
PAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEII
ADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTRAKKSISSHLCTLADFAIDMFDV
LDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVT
EEVHRLLKRCSYQFVCRGKVSVKGKGEMLTYFLEGRTDGNSSHGRTFRLERRMCPYGRGG
GQARRPPLCPAAGPPVRPGLPPAPTSQYLSSTAAGKEA
NT seq 3357 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggccaaggcggcggcggaggcgcgggcgagcccgggggcgca
gagcgggcggccgggccgggcggccggcgtgggttccgggcgtgtggcgaggagttcgcg
tgccccgagctggaggcgctgttccgcggctacacgttgcggctggagcaggcggccacg
ttgaaagcgctggctgtgctcagcctactggcgggcgccctggcgctggctgagctgctg
ggcgcaccggggccagcgcccggcctcgccaaggggtcgcacccagtgcactgcatcctt
ttcctggcgctgttcgtggtcaccaatgtccgatccctgcaggtgtcccagctgcagcag
gtcggtcagctggcgctgttcttcagcctcaccttcgcgctactctgctgccccttcgcg
ctgggcggccccgcgaggagctctgcaggaggcgcaatgggctcgacggtcgccgagcag
ggggtttggcaactccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgcagc
ctactggccatcggcttcgggctggtggtggctgcctcgcacttactggtcacagccgcc
ttggtccctgccaagcgcccacgtctctggaggacgctcggtgccaatgccctgctcttc
tttggtgtgaacatgtatggcgtcttcgtgcggatcttgacagagcgctcccagaggaag
gccttcctgcaggctcgaaactgcattgaggaccggctgcggctggaggatgagaatgag
aagcaggaacggttgctcatgagcctcttgccccggaatgtcgccatggagatgaaggaa
gacttcctgaagccccctgagaggatttttcacaagatttacatccagaggcatgacaat
gtgagcatcctgtttgcagacatcgtgggtttcacaggtctggcgtcccagtgcacagcc
caggagctggtgaaactgctcaatgaactctttggcaagttcgatgagttagccacggaa
aaccactgtcgccgaatcaagatccttggtgactgctactactgtgtgtctggcctcacc
cagcctaagacggatcacgcccactgctgtgtggagatgggacttgacatgatcgatacc
atcacatccgtggctgaagctactgaagtagacctgaacatgcgtgtgggcctacacacc
ggcagggtcctctgtggtgtcctgggcctacgaaagtggcagtatgatgtatggtccaat
gacgtgaccctggccaatgtcatggaggctgctggcttaccagggaaggtccacatcaca
aagacgaccctcgcatgcttgaacggggactacgaggtggagccaggtcatggccatgag
aggaacacctttctgagaactcacaagattgagaccttctttattgtgccatcccatcgg
aggaagatattcccaggcttgattctctcggatatcaaaccagccaagaggatgaagttc
aagactgtgtgctatctgctggtgcagctcatgcactgccggaaaatgttcaaggctgag
atccccttctccaacgtgatgacctgcgaggatgacgacaagcggagggcattgagaaca
gcctcggagaagctcagaaaccgttcgtctttctctactaatgtggtctacaccactccg
ggtacacgcgtcaacaggtacatcagccgccttctcgaagcccgccagacagagctggag
atggctgatctgaacttctttactctgaagtacaaacatgtcgaacgagaacaaaaatac
caccagcttcaggacgagtacttcaccagcgccgttgtcctcgccctcatcctggctgcc
ttatttgggcttatctaccttctggtaatcccacagagtgtggctgtcctgctgctgctg
gtattttccatctgcttcttggtggcctgtaccctgtacctgcacatcacgcgggtccag
tgttttccagggtgcctgacgatccagatccgcaccgccttgtgtgtgttcatagtggtc
ttaatctactcagtagctcaaggctgtgtggtgggctgcctgccctgggcctggagctct
cagtctaacagttccctagtggtcctcgcagctggtggccggcgcactgtgctgcctgcc
ctgccctgtgagtctgcacaccatgccctgctctgctgcctggtgggcaccctcccacta
gccatattcctgcgggtgtcctccttgccaaagatgatcctgctgtctgggctgactact
tcctacatccttgtcctagagctcagtggatacaccaaggttgggggcggtgccctctct
gggcgcagctatgagccaatcatggctatcctgctgttctcatgcacgctggccctgcac
gctaggcaagtggatgtcagactacggctggactacctctgggcggcacaggcggaggag
gaacgggatgacatggagagagtcaagctggacaacaagaggatcctcttcaatctcctg
ccagctcacgtcgcacagcacttcctcatgtccaatccccggaacatggacctctactac
cagtcctactcccaggtgggcgtcatgtttgcctccatccccaacttcaatgacttctac
atagaactggatggcaacaacatgggtgttgagtgtctgcggctcctcaacgagatcatt
gccgactttgatgagctcatggacaaggacttctacaaggacctggagaagatcaagacc
attgggagtacttacatggctgccgtggggctggcgcccacagcaggaaccagggctaag
aagtccatctcgtcccacctgtgcacactggcagacttcgccattgacatgtttgatgtt
ctggatgaaatcaactaccagtcctacaacgactttgttctccgagttggcatcaacgtt
ggccccgtggttgctggagtgatcggtgctcgcaggccccagtacgacatctggggaaac
acagtcaatgtggccagtcggatggatagcactggggtccagggacgaattcaggtgact
gaggaagtccaccggctgctgaagaggtgctcataccagttcgtatgcagaggcaaagtc
agcgtgaagggcaagggagagatgctaacgtactttctagaaggcaggactgatggaaac
agttcccacggcaggacctttcgcttggaacgaaggatgtgtccttacgggagaggtgga
ggccaggccagacggcccccactgtgtccggcggctggacccccagtcagaccagggctc
cctccagcccccactagccagtacctgtcatccacagcagcagggaaggaagcctag

KEGG   Mus caroli (Ryukyu mouse): 110306494
Entry
110306494         CDS       T05910                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04727  GABAergic synapse
mcal04740  Olfactory transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04962  Vasopressin-regulated water reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05032  Morphine addiction
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110306494 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110306494 (Adcy3)
   04371 Apelin signaling pathway
    110306494 (Adcy3)
   04020 Calcium signaling pathway
    110306494 (Adcy3)
   04072 Phospholipase D signaling pathway
    110306494 (Adcy3)
   04024 cAMP signaling pathway
    110306494 (Adcy3)
   04022 cGMP-PKG signaling pathway
    110306494 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110306494 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110306494 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110306494 (Adcy3)
   04062 Chemokine signaling pathway
    110306494 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    110306494 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    110306494 (Adcy3)
   04912 GnRH signaling pathway
    110306494 (Adcy3)
   04913 Ovarian steroidogenesis
    110306494 (Adcy3)
   04915 Estrogen signaling pathway
    110306494 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    110306494 (Adcy3)
   04921 Oxytocin signaling pathway
    110306494 (Adcy3)
   04926 Relaxin signaling pathway
    110306494 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    110306494 (Adcy3)
   04918 Thyroid hormone synthesis
    110306494 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    110306494 (Adcy3)
   04916 Melanogenesis
    110306494 (Adcy3)
   04925 Aldosterone synthesis and secretion
    110306494 (Adcy3)
   04927 Cortisol synthesis and secretion
    110306494 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110306494 (Adcy3)
   04270 Vascular smooth muscle contraction
    110306494 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    110306494 (Adcy3)
   04971 Gastric acid secretion
    110306494 (Adcy3)
   04972 Pancreatic secretion
    110306494 (Adcy3)
   04976 Bile secretion
    110306494 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110306494 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110306494 (Adcy3)
   04727 GABAergic synapse
    110306494 (Adcy3)
   04725 Cholinergic synapse
    110306494 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    110306494 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    110306494 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    110306494 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    110306494 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    110306494 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110306494 (Adcy3)
   04714 Thermogenesis
    110306494 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306494 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    110306494 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110306494 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110306494 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110306494 (Adcy3)
   05163 Human cytomegalovirus infection
    110306494 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110306494 (Adcy3)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110306494 (Adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N
Other DBs
NCBI-GeneID: 110306494
NCBI-ProteinID: XP_021034267
Ensembl: MGP_CAROLIEiJ_G0017580
UniProt: A0A6P5QSN1
LinkDB
Position
12
AA seq 1144 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLMVAGVGLVLDII
LFVLCKKGLLPDRVSRKVVPYLLWLLISAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDELEGMQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAQNGLNGSAMPNGAPASSKPSSPALIETKEPNGSAPAS
GSTSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILIDPWLMTNY
VTFVVGEVLLLILTICSMAAIFPRSFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMANV
VDMLSCLQYYMGPYNMTAGMELDGGCMENPKYYNYVAVLSLIATIMLVQVSHMVKLTLML
LVTGAVTAINLYAWCPVFDEYDHKRFQEKDTPMVALEKMQVLATPGLNGTDRLPLVPSKY
SMTVMMFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQV
VDNP
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcggatcccgagtactcggcagagtactcagccgagtac
tcggtcagcctgccctctgaccccgaccgcggggtcggccggacccatgaaatttctgtg
cggaactcggggtcctgcctgtgcctgcctcgctttatgcggctgaccttcgtgcctgag
tccttggagaacctctaccagacctacttcaaaaggcagcgccatgagaccctgctggtg
ctggtggtctttgcggccctctttgactgctacgtggtagtgatgtgcgcggtggtcttc
tccagcgacaagctggcgcccctcatggtggcaggcgtcggtctggtgttggacatcatc
cttttcgtgctctgtaaaaaggggctgctcccagaccgagtgagccgcaaagtggtaccc
tacctgctgtggctgctcatctcggcccagatcttctcctacctgggcctgaacttttca
cgcgcccacgcagccagtgacactgtgggttggcaggccttctttgtcttctccttcttc
ataacgctgcccctcagcctcagccccatcgtgatcatctctgtggtctcctgtgttgtg
cacacgcttgtcttgggggtcactgtggcccagcagcagcaggatgagctggaagggatg
cagctgctgagggagatcctggccaacgtcttcctctacctgtgtgctatcatcgtgggc
atcatgtcctactacatggcagatcgcaagcatcgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaatctggaggagcagagccagcagcaggaaaaccttatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaggacatgaagaaggacgagagt
cagaaggaccagcagcagttcaataccatgtacatgtaccggcacgagaatgtcagcatc
ctgtttgcagatattgtgggctttacccagctgtcctctgcttgcagtgcccaggagctc
gtgaagttactcaacgagctcttcgcccgctttgacaagctggcggccaaataccaccag
ctgaggatcaagatcctaggcgactgttactactgcatctgcggcctgcctgactaccgg
gaggaccacgccgtgtgctccatccttatggggcttgccatggtagaggccatctcgtac
gtgcgggagaagaccaagactggagtggacatgcgtgtgggagtgcacacaggcactgtc
ctaggtggtgtcctgggccagaagcgctggcagtatgatgtatggtctactgatgtcacc
gtggcaaacaagatggaggctggtggcatcccagggcgcgtgcacatttctcagagcacc
atggactgtctgaagggggagtttgatgtggagcctggtgatgggggcagtcgctgcgac
tacctagatgagaagggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagcccaaaatggcctcaacggctcggccatgccaaacggagcgccggcatcctcc
aaacccagctcccctgccctcatcgagaccaaggagcccaatggaagtgcccctgccagc
ggctccacatcagaggaggctgaagaacaggaggcccaggctgacaacccctcgttcccc
aacccccgccgcaggctgcgcctccaggacctggcggaccgtgtggtggacgcctctgag
gatgagcacgaactgaaccagctgcttaacgaggccctgctggagcgggagtccgcccag
gtggtaaagaagagaaacacattcctcctgaccatgaggttcatggacccagagatggaa
acacgctactcggtggagaaggagaagcagagcggggctgccttcagttgctcctgtgtg
gtcctcttctgcacagccatggtggagatactcatcgacccctggctgatgacaaactat
gtgacctttgtggttggggaggttctgctcctgatcctgaccatctgctccatggctgcc
atctttcccaggtcatttcccaagaagctcgtggccttctcatcttggattgaccggacc
cgctgggcacggaacacctgggccatgttagccatcttcattctggttatggccaatgtt
gtggacatgcttagctgtctccagtactacatgggaccttacaacatgacagctgggatg
gagctggacggcggctgcatggagaaccccaagtactacaactatgtagctgtgctgtcg
ctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctgacgctcatgctg
ctcgtcacaggcgccgtgactgccatcaacctgtacgcctggtgtcctgtctttgatgaa
tacgaccacaagcgctttcaggaaaaggacactcccatggtggccttagagaagatgcag
gtacttgccacccctgggctcaatggcactgacaggctgcccctggtgccttccaagtac
tccatgactgtgatgatgttcgtcatgatgctgagcttttactacttctcgcgccacgtg
gaaaaactggcccgaacactgttcttgtggaagattgaggtccatgaccagaaagaacgt
gtctacgaaatgcgccgatggaatgaggccttggtcaccaacatgttgcctgagcatgtt
gcacgccattttctggggtccaagaagagagatgaggagctgtacagccagtcttatgac
gagattggagtcatgtttgcctccttgcccaactttgccgacttctacactgaggagagc
atcaacaacggtggcatcgagtgtctacgcttcctcaatgagatcatctctgattttgac
tctctcctggacaatcccaaattccgggtcatcaccaagatcaaaactattggcagcacc
tatatggcagcttcaggagtcacaccagatgtcaacaccaatggctttacaagctccagc
aaggaggagaagtcagacaaggagcgttggcagcacctggctgacctggccgactttgca
ttagccatgaaggacacgctcacaaacatcaacaaccagtcattcaacaacttcatgttg
cgcataggcatgaacaaaggaggggttctggctggcgtcattggagcccggaaaccacac
tatgacatctggggcaatacggtcaatgtggccagcaggatggaatccacaggagtcatg
ggcaacatccaggtggtggaagagacgcaggtcatccttcgagagtatggcttccgcttt
gtgaggcgaggtcccatctttgtgaaaggcaaaggggagcttctgacctttttcttgaag
gggcgggacaggccagctgccttccccaatggctcctctgttaccctgccccaccaagtg
gtggacaacccctga

KEGG   Mus caroli (Ryukyu mouse): 110307661
Entry
110307661         CDS       T05910                                 

Gene name
Adcy2
Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04727  GABAergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05032  Morphine addiction
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110307661 (Adcy2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110307661 (Adcy2)
   04371 Apelin signaling pathway
    110307661 (Adcy2)
   04020 Calcium signaling pathway
    110307661 (Adcy2)
   04072 Phospholipase D signaling pathway
    110307661 (Adcy2)
   04024 cAMP signaling pathway
    110307661 (Adcy2)
   04022 cGMP-PKG signaling pathway
    110307661 (Adcy2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110307661 (Adcy2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110307661 (Adcy2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110307661 (Adcy2)
   04062 Chemokine signaling pathway
    110307661 (Adcy2)
  09152 Endocrine system
   04911 Insulin secretion
    110307661 (Adcy2)
   04922 Glucagon signaling pathway
    110307661 (Adcy2)
   04923 Regulation of lipolysis in adipocytes
    110307661 (Adcy2)
   04912 GnRH signaling pathway
    110307661 (Adcy2)
   04913 Ovarian steroidogenesis
    110307661 (Adcy2)
   04915 Estrogen signaling pathway
    110307661 (Adcy2)
   04914 Progesterone-mediated oocyte maturation
    110307661 (Adcy2)
   04921 Oxytocin signaling pathway
    110307661 (Adcy2)
   04926 Relaxin signaling pathway
    110307661 (Adcy2)
   04935 Growth hormone synthesis, secretion and action
    110307661 (Adcy2)
   04918 Thyroid hormone synthesis
    110307661 (Adcy2)
   04928 Parathyroid hormone synthesis, secretion and action
    110307661 (Adcy2)
   04916 Melanogenesis
    110307661 (Adcy2)
   04925 Aldosterone synthesis and secretion
    110307661 (Adcy2)
   04927 Cortisol synthesis and secretion
    110307661 (Adcy2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110307661 (Adcy2)
   04270 Vascular smooth muscle contraction
    110307661 (Adcy2)
  09154 Digestive system
   04970 Salivary secretion
    110307661 (Adcy2)
   04971 Gastric acid secretion
    110307661 (Adcy2)
   04972 Pancreatic secretion
    110307661 (Adcy2)
   04976 Bile secretion
    110307661 (Adcy2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110307661 (Adcy2)
   04727 GABAergic synapse
    110307661 (Adcy2)
   04725 Cholinergic synapse
    110307661 (Adcy2)
   04723 Retrograde endocannabinoid signaling
    110307661 (Adcy2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110307661 (Adcy2)
  09149 Aging
   04211 Longevity regulating pathway
    110307661 (Adcy2)
   04213 Longevity regulating pathway - multiple species
    110307661 (Adcy2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110307661 (Adcy2)
   04714 Thermogenesis
    110307661 (Adcy2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110307661 (Adcy2)
  09165 Substance dependence
   05032 Morphine addiction
    110307661 (Adcy2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110307661 (Adcy2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110307661 (Adcy2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110307661 (Adcy2)
   05163 Human cytomegalovirus infection
    110307661 (Adcy2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110307661 (Adcy2)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110307661 (Adcy2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA DUF349
Other DBs
NCBI-GeneID: 110307661
NCBI-ProteinID: XP_021035567
Ensembl: MGP_CAROLIEiJ_G0018688
UniProt: A0A6P5QVK5
LinkDB
Position
13
AA seq 1095 aa
MWQEAMRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMG
ACLALLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRVFSLVIWIC
LVAMGYLFMCFGGTVSAWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVY
LSATPGAKEHLFWQILANVIIFICGNLAGAYHKHLMELALQQTYRDTCNCIKSRIKLEFE
KRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADI
VGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAK
NCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHM
EAGGVPGRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPKGERRSPQHL
FRPRHTLDGAKMRASVRMTQYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQ
NRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLFFYNKNIEKEYRATA
LPAFKYYVTCACLIFLCIFIVQILVLPKTSILGFSFGAAFLSLIFILFVCFAGQLLQCSK
KASASLMWLLKSSGIIANRPWPRISLTIVTTAIILTMAVFNMFFLSNSEETTLPTANASN
ANVSVPDNQTAILHARNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNII
LLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFFITLLVLGRQSEYYCRLDFLWKN
KFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDF
KEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPS
QEHAQEPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKP
QYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFV
NTEMSRSLSQSNLAS
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcggcgccgctacctgcgggaccgcgccgaggcggcggcg
gcagcggcggcgggcggcggcgaggggctgcagcggtcccgggactggctctacgagtcc
tactactgcatgagccagcagcaccctctcatcgtcttcctgctgctcatcgtcatgggc
gcctgcctcgccctgctcgccgtcttcttcgcgctcgggctggaggtggaagaccatgtg
gcatttttaataaccgttcccactgccctggccatcttcttcgccatattcattcttgtc
tgcattgagtctgtgttcaagaagctgctccgcgtgttctcgctggtgatctggatatgt
ctggttgccatgggatacctgttcatgtgctttggagggaccgtgtctgcctgggaccag
gtgtcattcttcctcttcatcatcttcgtggtatacactatgcttcccttcaacatgagg
gatgccatcattgcgagcgtcctcacctcttcatctcatacgatagtgctgagcgtctac
ctgtctgcaacaccaggggccaaggagcacctgttctggcagatactggccaacgtgatc
attttcatctgtgggaacttggcgggagcttaccataagcacctcatggaacttgccctg
cagcaaacctatcgggacacttgtaattgcatcaagtcccggatcaagctggaatttgaa
aaacggcagcaggaacgacttctgctttccttgctgccggctcacatcgccatggagatg
aaggctgaaatcattcagaggctacagggacccaaagcaggacagatggaaaacacgaac
aacttccacaacctgtatgtcaagcgacacaccaacgtgagcatattatatgctgacatt
gttggcttcacccgtctcgcaagcgactgctcccctggtgaactggtccatatgctgaat
gaactctttgggaagttcgatcaaattgcaaaggagaatgagtgcatgagaattaaaatt
ttaggagactgctattactgtgtttccgggctccctatatctctccctaaccatgccaag
aactgtgtgaaaatgggactggatatgtgcgaagccataaagaaagtgagggatgctact
ggggtcgatatcaacatgcgtgtgggagtgcattctgggaacgttctctgtggtgtgatt
ggtctccagaagtggcagtatgacgtgtggtctcatgatgttactttggccaaccacatg
gaagctggaggagtccctggacgtgttcacatttcctcagtcactctggagcacttgaat
ggggcttataaagtggaggaaggagacggtgagataagagacccatatttaaagcagcat
ttggtgaaaacctactttgtaatcaaccccaagggagaaagacggagtcctcagcatctc
ttcagacctcgacacactctggatggagccaaaatgagagcatctgtccgcatgacccag
tacttggagtcctggggagcagccaagccatttgcacatctgcaccacagagatagcatg
accacagagaatgggaagattagcaccacggatgtgccaatgggtcaacataattttcaa
aatcgcaccttaagaactaagtcacagaagaagcgattcgaagaagaactgaatgaaagg
atgatccaagcaattgacgggatcaatgcacagaagcaatggctcaagtcagaagacatt
caaagaatctccctgtttttctataacaaaaatatagaaaaagaataccgagccactgca
ctgccagcattcaagtactacgtgacctgtgcctgcctcatcttcctctgtatcttcatt
gtacagattcttgtactgccaaaaacatccatccttggcttctcctttggagctgcattt
ctctccctcatcttcatcctctttgtctgcttcgctggacagcttttgcaatgcagcaaa
aaggcctctgcctctctcatgtggcttttgaaatcatcaggcatcatagccaaccgccca
tggccacggatctccctcacgatcgtcaccacagctatcatactaaccatggctgtgttt
aacatgtttttcctgagcaactctgaggagacaacccttccaactgcgaatgcatctaat
gcaaacgtttctgtcccagataaccagacagcgattcttcatgcacgaaacttgtttttc
ctcccgtacttcatatacagctgcattctgggattgatctcctgctccgttttcctgagg
gtgaactacgagttgaaaatgttaatcatgatggtggcactcgtgggctacaacatcatt
ctgctccacacccatgcccatgtcctggatgcatacagccaggtcctgtttcagagacca
ggcatttggaaagacctgaagaccatgggctctgtgtccctctctatattcttcatcacg
ctgctcgttctgggtagacagagtgaatattactgtaggttagacttcttgtggaagaac
aagttcaaaaaagagcgggaggagatcgaaaccatggagaacctaaaccgagtgctgctg
gagaacgtgcttcctgcacacgtggctgaacacttcctggccaggagcctgaaaaatgag
gagttataccaccagtcctacgattgtgtctgcgtcatgtttgcctccattccggacttc
aaggaattctacacggagtcagatgtgaacaaggaaggcttggaatgcctccggctcctg
aatgagatcatcgctgactttgatgatctgctttccaagccgaagttcagtggcgttgaa
aagatcaagaccattggtagcacatacatggcagccacgggtctgagtgctgtacccagc
caggagcacgcccaggaacccgagcgtcaatacatgcacataggcaccatggtggagttt
gcatacgccctggtggggaaactggatgccatcaataagcactccttcaacgacttcaaa
cttcgagtgggtatcaaccatggacctgtaatagctggcgtcataggggctcagaagcca
caatatgacatctggggcaacactgtcaacgtcgccagtaggatggacagcaccggagtc
ctggacaaaatacaggtgactgaggagacaagcctcatcctgcagacacttggctacacg
tgtacatgtcgaggtatcatcaacgtgaaggggaaaggggacctgaagacgtactttgta
aacaccgagatgtcacggtccctttctcagagcaacttggcttcctga

KEGG   Mus caroli (Ryukyu mouse): 110309267
Entry
110309267         CDS       T05910                                 

Gene name
Adcy4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04727  GABAergic synapse
mcal04742  Taste transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05032  Morphine addiction
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110309267 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110309267 (Adcy4)
   04371 Apelin signaling pathway
    110309267 (Adcy4)
   04020 Calcium signaling pathway
    110309267 (Adcy4)
   04072 Phospholipase D signaling pathway
    110309267 (Adcy4)
   04024 cAMP signaling pathway
    110309267 (Adcy4)
   04022 cGMP-PKG signaling pathway
    110309267 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110309267 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110309267 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110309267 (Adcy4)
   04062 Chemokine signaling pathway
    110309267 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    110309267 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    110309267 (Adcy4)
   04912 GnRH signaling pathway
    110309267 (Adcy4)
   04913 Ovarian steroidogenesis
    110309267 (Adcy4)
   04915 Estrogen signaling pathway
    110309267 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    110309267 (Adcy4)
   04921 Oxytocin signaling pathway
    110309267 (Adcy4)
   04926 Relaxin signaling pathway
    110309267 (Adcy4)
   04935 Growth hormone synthesis, secretion and action
    110309267 (Adcy4)
   04918 Thyroid hormone synthesis
    110309267 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    110309267 (Adcy4)
   04916 Melanogenesis
    110309267 (Adcy4)
   04925 Aldosterone synthesis and secretion
    110309267 (Adcy4)
   04927 Cortisol synthesis and secretion
    110309267 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110309267 (Adcy4)
   04270 Vascular smooth muscle contraction
    110309267 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    110309267 (Adcy4)
   04971 Gastric acid secretion
    110309267 (Adcy4)
   04972 Pancreatic secretion
    110309267 (Adcy4)
   04976 Bile secretion
    110309267 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    110309267 (Adcy4)
   04727 GABAergic synapse
    110309267 (Adcy4)
   04725 Cholinergic synapse
    110309267 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    110309267 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    110309267 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    110309267 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    110309267 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    110309267 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110309267 (Adcy4)
   04714 Thermogenesis
    110309267 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309267 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    110309267 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110309267 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110309267 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110309267 (Adcy4)
   05163 Human cytomegalovirus infection
    110309267 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110309267 (Adcy4)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110309267 (Adcy4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 110309267
NCBI-ProteinID: XP_021037475
Ensembl: MGP_CAROLIEiJ_G0019319
UniProt: A0A6P5R2D1
LinkDB
Position
14
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLILLLVIVLCALVALPAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQQLQRWTRPLSGLIWVALLALGYGFLFTGGVVSAWDQV
SFFLFIIFTVYAMLPLGMRDAAAAGVISSLSHLLVLGLYLGWQPESQRALLPQLAANAVL
FLCGNLVGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQHSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRVATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVERADTEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAKGLLSSLEGHTMRPSLLMTR
YLESWGAAKPFAHLSHLDCPVSTSTPLPEKAFSPQWSLDRSRTPRGLDDELDTGDAKFFQ
VIEQLNSQKQWKQSKDFNLLTLYFREKEMEKQYRLSALPAFKYYAACTFLVFLSNFTIQM
LVTTRPPALIITYSITFLLFFLLLFVCFSEHLTKCVQKGPKMLHWLPALSVLVATRPGFR
VALGTATILLVFTMAIASLLFLPVSSDCLFLASNVSSVTFNASWEMPGSLPLISIPLISI
PYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLIARLYQSPS
DSRPGVLKEPKLMGAIYFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLT
RLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLEC
LRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDAERSCSHLGT
MVEFAVALGSKLGVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRME
STGVLGKIQVTEETARALQSLGYTCYSRGSIKVKGKGELYTYFLNTDLTRTGSPSAS
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggcctcctcccagcgaagatctcttctacgaaacttac
tacagcctgagccaacagtacccactgctgatactgcttttggtcattgtgctctgcgcg
ctggtggcactgcccgccgtcgcctgggccagcggcagggagctgacctcagacccaagc
ttcctgacaactgtgctgtgtgctttgggtggcttctctctgctattggggctcgcttcc
cgggagcagcaactgcagcgatggacacgacctctttctggtctcatatgggttgcattg
ctggctttgggctatggatttctgttcactgggggtgtggtgagtgcctgggaccaggtg
tcttttttcctcttcatcatcttcaccgtgtacgccatgctgcccttgggcatgcgggat
gctgctgctgcgggggtcatctcatccctctctcacctgctggtccttggactgtatctt
gggtggcagcctgagtcacagagagctctgctaccacagttggcagcaaacgcggtgttg
ttcctgtgtgggaacctggtgggggcgtaccacaaggccctgatggagcgagcattgcgg
gccacgttccgggaggctcttagctctctgcactcacgccggaggctggacactgagaaa
aagcaccaggagcacctcctcttgtccatccttcctgcctacctggcccgagagatgaaa
gcagagatcatggcccggctgcaggctggacagcactcacggccagagaacacaaacaac
tttcacagcctgtacgtcaagaggcaccaaggagtgagtgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagtgagtgttccccaaaggagctggtgctcatgctgaatgag
ctctttggcaagttcgaccagattgccaaggagcacgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtgtccgggctgcccctctcgctgcctgaccacgctatcaat
tgtgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggtagccaccggt
gtggatatcaacatgcgcgtgggcgtgcactcgggcagcgttctctgtggagtcatcggg
ctacagaagtggcagtatgatgtctggtcccatgatgtcacattggccaaccatatggaa
gcagggggtgtaccaggacgagtgcacatcacaggggccacactggccctgctagcagga
gcttatgctgtggaaagggcagacacggaacaccgagacccgtaccttcgggagctaggc
gaacctacatacctggtcattgaccctcgggctgaggaggaagacgagaagggcaccgca
aaaggattgctgtcttctctggaggggcacacgatgcgtccgtcacttctgatgactcgc
tatctggagtcttggggtgcagccaagcctttcgcccacctaagccaccttgactgtcct
gtgtctacctccactccactaccggagaaagccttcagcccccagtggagcctggaccgg
agtcgcaccccccggggactagatgatgagctggacactggtgatgccaagttcttccag
gtcatcgaacaactcaactctcagaaacagtggaagcagtcgaaggacttcaacctcctg
acgctgtacttcagagagaaggagatggagaaacagtatcggctctctgcacttccagcg
ttcaaatactacgcagcctgcaccttcctggtttttctgtccaacttcactatccaaatg
ctggtgacaaccaggcccccagctctgatcatcacctacagcatcaccttccttctcttc
tttctcctcctcttcgtctgcttctcagagcacctgacgaagtgtgtccagaaaggtccc
aagatgttgcactggctgcctgcactgtctgtcctggtggccacacggccaggatttcga
gtagccctgggcacggccaccatcctcctagtattcactatggccatcgccagcctgctc
ttcttaccagtgtcatcagactgccttttcctggcttccaatgtgtcgtctgtgactttc
aatgcttcctgggagatgccaggatccctgcccctcatcagcatccccctcatcagcatc
ccatactccatgcattgctgcgtgttgggtttcctctcctgctccctttttctgcacatg
agcttcgaactgaagctgctcctacttctgctgtggctggtggcatcttgttccctattt
ctgcattcccacgcctggctgtccgactgcctcattgcccgcctttatcaaagcccttca
gactccaggccaggggtgctgaaggaacccaagctgatgggagctatctacttcttcatc
ttcttcttcacactcctggtcctggctcggcagaatgagtattactgccgcctggacttc
ctgtggaaaaagaaactgaggcaggagcgagaggagactgagacgatggagaacctgacc
cggctcctcctggagaatgtactccctgcacacgtggccccccagttcatcggccagaac
cggcgcaatgaggacctctaccaccagtcgtacgaatgcgtgtgtgtcctcttcgcatcg
gtcccagactttaaggaattctactctgaatccaacatcaaccacgaggggctggagtgc
ctgcggctgctcaatgagatcatcgctgactttgatgagctgctctccaagccaaagttc
agtggagtagaaaagatcaaaactattggcagtacctacatggcagccacaggcttaaat
gccacctctggacaggatactcaacaggatgctgagagaagctgcagtcatctgggcacc
atggtggaatttgcagtggccctggggtctaagctgggtgtcatcaacaagcactcgttc
aacaacttccgcctgcgtgtggggttgaaccacggaccagtagtagcaggggtgattggg
gcgcagaagccacagtatgacatctgggggaacacagtgaatgtggccagccgcatggag
agcacaggcgttctcggcaagatccaagtgactgaggagacagcgcgggccctgcagtct
ctgggttacacatgctatagcagaggcagcatcaaggtcaaaggcaaaggggaactctat
acctacttcctgaacacagacctgacgcggaccggatctccctcagcatcctag

KEGG   Mus caroli (Ryukyu mouse): 110310126
Entry
110310126         CDS       T05910                                 

Gene name
Adcy6
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04727  GABAergic synapse
mcal04742  Taste transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04962  Vasopressin-regulated water reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05032  Morphine addiction
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110310126 (Adcy6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110310126 (Adcy6)
   04371 Apelin signaling pathway
    110310126 (Adcy6)
   04072 Phospholipase D signaling pathway
    110310126 (Adcy6)
   04024 cAMP signaling pathway
    110310126 (Adcy6)
   04022 cGMP-PKG signaling pathway
    110310126 (Adcy6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110310126 (Adcy6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110310126 (Adcy6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110310126 (Adcy6)
   04062 Chemokine signaling pathway
    110310126 (Adcy6)
  09152 Endocrine system
   04911 Insulin secretion
    110310126 (Adcy6)
   04923 Regulation of lipolysis in adipocytes
    110310126 (Adcy6)
   04912 GnRH signaling pathway
    110310126 (Adcy6)
   04913 Ovarian steroidogenesis
    110310126 (Adcy6)
   04915 Estrogen signaling pathway
    110310126 (Adcy6)
   04914 Progesterone-mediated oocyte maturation
    110310126 (Adcy6)
   04921 Oxytocin signaling pathway
    110310126 (Adcy6)
   04926 Relaxin signaling pathway
    110310126 (Adcy6)
   04935 Growth hormone synthesis, secretion and action
    110310126 (Adcy6)
   04918 Thyroid hormone synthesis
    110310126 (Adcy6)
   04928 Parathyroid hormone synthesis, secretion and action
    110310126 (Adcy6)
   04916 Melanogenesis
    110310126 (Adcy6)
   04924 Renin secretion
    110310126 (Adcy6)
   04925 Aldosterone synthesis and secretion
    110310126 (Adcy6)
   04927 Cortisol synthesis and secretion
    110310126 (Adcy6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110310126 (Adcy6)
   04270 Vascular smooth muscle contraction
    110310126 (Adcy6)
  09154 Digestive system
   04970 Salivary secretion
    110310126 (Adcy6)
   04971 Gastric acid secretion
    110310126 (Adcy6)
   04972 Pancreatic secretion
    110310126 (Adcy6)
   04976 Bile secretion
    110310126 (Adcy6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110310126 (Adcy6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110310126 (Adcy6)
  09156 Nervous system
   04724 Glutamatergic synapse
    110310126 (Adcy6)
   04727 GABAergic synapse
    110310126 (Adcy6)
   04725 Cholinergic synapse
    110310126 (Adcy6)
   04723 Retrograde endocannabinoid signaling
    110310126 (Adcy6)
  09157 Sensory system
   04742 Taste transduction
    110310126 (Adcy6)
   04750 Inflammatory mediator regulation of TRP channels
    110310126 (Adcy6)
  09149 Aging
   04211 Longevity regulating pathway
    110310126 (Adcy6)
   04213 Longevity regulating pathway - multiple species
    110310126 (Adcy6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110310126 (Adcy6)
   04714 Thermogenesis
    110310126 (Adcy6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310126 (Adcy6)
  09165 Substance dependence
   05032 Morphine addiction
    110310126 (Adcy6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110310126 (Adcy6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110310126 (Adcy6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110310126 (Adcy6)
   05163 Human cytomegalovirus infection
    110310126 (Adcy6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110310126 (Adcy6)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110310126 (Adcy6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 110310126
NCBI-ProteinID: XP_021038473
Ensembl: MGP_CAROLIEiJ_G0020238
UniProt: A0A6P5R2L5
LinkDB
Position
15
AA seq 1180 aa
MPLPAARSGSVRSSMSWFSGLLVPKVDERKTAWGERNGQKRPRHANRASGFCAPRYMSCL
KNAEPPSPTPAAHTRCPWQDEAFIRRAGPGRGVELGLRSVALGFDDTEVTTPMGTAEVAP
DTSPRSGPSCWHRLVQVFESKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLT
FHAAPAQPQPAYVALLTCASVLFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGAL
AANPHSPSAGLWCPVFFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWQLNSSDPFLWKQ
LGANVVLFLCTNAIGVCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQ
HVAMEMKEDINTKKEEMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELF
ARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVN
VNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDY
EVEPGRGGERNAYLKEQCIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDR
AFSRTKDSKAFRQMGIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRF
LLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLVFPYSTLILGIYATIFLLL
LVTVLICAVCSCGSFFPKALQRLSRNIVRSRVHSTAVGIFSVLLVFISAIANMFTCNHTP
IRTCAARMLNLTPADVTACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNVLLSLLASS
VFLHISSIGKLAMTFVLGFTYLVLLLLGPPAAIFDNYDLLLSVHGLASSNETFDGLDCPA
VGRVALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLL
HNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLL
NEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLME
QMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQV
TTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3543 nt   +upstreamnt  +downstreamnt
atgcccctgcccgcagcccgatccggttctgtgcgcagcagcatgtcatggtttagtggc
ctcctggttcccaaagtggatgaacggaaaacagcttggggggaacgcaatgggcagaag
cgcccacgccatgcgaatcgagccagtggcttctgcgcaccccgctacatgagctgcctc
aagaatgcggagccacccagccccactcctgcagctcacactcggtgcccctggcaggat
gaagccttcatcaggagggcgggcccgggcaggggtgtggagctggggctgcggtcagtg
gccttggggtttgacgacactgaggtgaccacaccgatggggacagctgaagtggcaccg
gatacatcgcctcggagcggtccgtcctgctggcaccggcttgtgcaggtgttcgagtct
aagcagttccgctctgccaaactggagcggctgtaccagcggtacttcttccagatgaac
cagagcagcctcacgctgctcatggcggtgctggtgctgctcatggctgtactgttgact
ttccacgctgcgcctgcccagcctcagcctgcttacgtggccctgctgacctgtgcctcc
gtcctttttgtggtactcatggtggtgtgtaaccgacacagcttccgccaggactccatg
tgggtggtgagctatgtggtcctgggcatcctagcagctgtgcaagtcgggggtgccctg
gcagccaatccacacagcccctcggcgggcctttggtgccccgtgttcttcgtctacatc
acctacacccttcttcccattcgcatgcgagccgcagtgctcagcggcctgggcctctct
actctgcatttgattttggcctggcagctcaacagcagcgaccccttcctttggaagcag
ctcggtgctaacgtggtgctcttcctctgcaccaatgccatcggtgtctgcacacactac
cctgctgaagtgtctcagcgccaagcctttcaggagacccgaggttacatccaggcgcgg
ctgcacctacagcatgagaaccgtcagcaggaacggctgctgctatcggtgttgccccag
cacgttgccatggagatgaaagaagacatcaacacaaaaaaagaagagatgatgttccat
aagatctacatccagaagcatgataatgtcagcatcctatttgcggacattgagggcttc
accagcctggcctcccagtgcactgcacaggaactggtcatgaccttgaatgagctcttt
gcgcggtttgacaagctggctgcggagaatcactgtctgcggatcaagatcttaggggac
tgttactactgcgtgtcagggctgcccgaggcccgggcagaccatgcccactgctgtgtg
gagatgggggtagacatgatcgaagccatctcgctggtgcgtgaggtaacaggtgtgaac
gtgaacatgcgcgtgggcatccacagcggacgtgtgcattgcggcgtccttggcctacgg
aaatggcagttcgacgtctggtccaatgatgtgaccctggccaaccacatggaggccggg
ggccgggccggccgcatccacatcactcgggctacgctgcagtacctgaacggggactat
gaggtggagccaggccgtggtggtgagcgcaatgcgtacctcaaggagcagtgcattgag
accttcctcatactaggcgccagccaaaaacggaaagaggagaaagccatgctggccaag
cttcagcggacgcgggccaactccatggaaggactgatgccccgctgggttcctgaccgt
gccttctcccggaccaaggactctaaggcattccgccagatgggcattgatgactctagc
aaagacaaccggggtgcccaagatgctctgaaccctgaagatgaggtggatgagttcctg
ggccgagccattgatgcccgaagcatcgaccaactgcgtaaggaccatgtgcgccggttc
ctgctcaccttccagagagaggatcttgagaagaagtattcacggaaagtagatcctcgc
ttcggagcctacgtcgcctgtgccctcctggttttttgcttcatctgttttatccagctc
cttgtattcccatactctaccctgatactcgggatttatgccactatcttcctgctgttg
ctggtcactgtgctgatctgtgccgtgtgctcctgtggttctttcttccccaaggccctg
caacgcctgtcccgcaatatcgtccgctcacgggtgcacagcaccgcggttggaatcttc
tcggttctgcttgtgttcatctctgccatcgccaacatgtttacctgtaatcacacccca
ataaggacctgcgccgcccggatgctgaacttaacaccagcggatgtcaccgcctgccac
ctacaacagctcaattactctctgggactggatgctcccctgtgtgagggcaccgcaccc
acctgcagcttccctgagtacttcgtcgggaacgtgctgctgagtcttctggccagctct
gtcttcctacacatcagcagcatcggcaagctggccatgaccttcgtcttggggttcacc
tacttggtgctgcttttgctgggtcccccggccgccatctttgacaactatgatctactg
ctcagcgtccatggcttggcttcctccaatgagacctttgatgggctggactgcccagct
gtggggagggtagcgctcaaatatatgacccccgtgattctgctggtgtttgccctggca
ctgtatctgcatgcacaacaggtggaatcgactgctcgcctggacttcctgtggaagcta
caggcaacaggggagaaggaggagatggaggagctacaggcatacaaccggaggttgctg
cataacattcttcccaaggacgtggccgcccacttcctggcccgggaacgccgcaacgat
gagctgtactaccagtcgtgtgaatgtgtggctgtcatgtttgcctccatcgccaatttc
tcggagttctatgtggagctcgaagcaaacaacgagggtgtggagtgcctgcggctgctc
aatgagatcatcgcagactttgacgagatcatcagtgaggagagattccggcagttggag
aagatcaagaccatcggtagcacctacatggctgcctctgggctaaatgccagcacctat
gaccaggttggccgctcgcacatcacggcgctggctgactatgccatgcggctcatggag
cagatgaaacacatcaatgaacactctttcaacaatttccagatgaagatcgggttgaac
atgggtccggttgtagcaggtgtcattggggcccgaaagccacagtatgacatctgggga
aataccgtgaatgtttctagtcgtatggacagcactggagttcctgaccgaatacaggtg
accacggacctgtaccaggttctagctgccaagggctaccagctggagtgtcgaggggtg
gtcaaggtgaagggaaagggggagatgaccacctacttcctcaacgggggccccagcagt
tag

KEGG   Mus caroli (Ryukyu mouse): 110310371
Entry
110310371         CDS       T05910                                 

Gene name
Adcy8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04727  GABAergic synapse
mcal04742  Taste transduction
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05032  Morphine addiction
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110310371 (Adcy8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110310371 (Adcy8)
   04371 Apelin signaling pathway
    110310371 (Adcy8)
   04020 Calcium signaling pathway
    110310371 (Adcy8)
   04072 Phospholipase D signaling pathway
    110310371 (Adcy8)
   04024 cAMP signaling pathway
    110310371 (Adcy8)
   04022 cGMP-PKG signaling pathway
    110310371 (Adcy8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110310371 (Adcy8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110310371 (Adcy8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110310371 (Adcy8)
   04062 Chemokine signaling pathway
    110310371 (Adcy8)
  09152 Endocrine system
   04911 Insulin secretion
    110310371 (Adcy8)
   04923 Regulation of lipolysis in adipocytes
    110310371 (Adcy8)
   04912 GnRH signaling pathway
    110310371 (Adcy8)
   04913 Ovarian steroidogenesis
    110310371 (Adcy8)
   04915 Estrogen signaling pathway
    110310371 (Adcy8)
   04914 Progesterone-mediated oocyte maturation
    110310371 (Adcy8)
   04921 Oxytocin signaling pathway
    110310371 (Adcy8)
   04926 Relaxin signaling pathway
    110310371 (Adcy8)
   04935 Growth hormone synthesis, secretion and action
    110310371 (Adcy8)
   04918 Thyroid hormone synthesis
    110310371 (Adcy8)
   04928 Parathyroid hormone synthesis, secretion and action
    110310371 (Adcy8)
   04916 Melanogenesis
    110310371 (Adcy8)
   04925 Aldosterone synthesis and secretion
    110310371 (Adcy8)
   04927 Cortisol synthesis and secretion
    110310371 (Adcy8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110310371 (Adcy8)
   04270 Vascular smooth muscle contraction
    110310371 (Adcy8)
  09154 Digestive system
   04970 Salivary secretion
    110310371 (Adcy8)
   04971 Gastric acid secretion
    110310371 (Adcy8)
   04972 Pancreatic secretion
    110310371 (Adcy8)
   04976 Bile secretion
    110310371 (Adcy8)
  09156 Nervous system
   04724 Glutamatergic synapse
    110310371 (Adcy8)
   04727 GABAergic synapse
    110310371 (Adcy8)
   04725 Cholinergic synapse
    110310371 (Adcy8)
   04720 Long-term potentiation
    110310371 (Adcy8)
   04723 Retrograde endocannabinoid signaling
    110310371 (Adcy8)
  09157 Sensory system
   04742 Taste transduction
    110310371 (Adcy8)
   04750 Inflammatory mediator regulation of TRP channels
    110310371 (Adcy8)
  09149 Aging
   04211 Longevity regulating pathway
    110310371 (Adcy8)
   04213 Longevity regulating pathway - multiple species
    110310371 (Adcy8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110310371 (Adcy8)
   04714 Thermogenesis
    110310371 (Adcy8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310371 (Adcy8)
  09165 Substance dependence
   05032 Morphine addiction
    110310371 (Adcy8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110310371 (Adcy8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110310371 (Adcy8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110310371 (Adcy8)
   05163 Human cytomegalovirus infection
    110310371 (Adcy8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110310371 (Adcy8)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110310371 (Adcy8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 110310371
NCBI-ProteinID: XP_021038926
Ensembl: MGP_CAROLIEiJ_G0019841
UniProt: A0A6P5R5L7
LinkDB
Position
15
AA seq 1251 aa
MELSDVHCLSGSEELYTIQPTPPAGDDGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGG
GGGGSRKASNPAGSGPNHHTPQLSTDSVLPLYSLGPGERAHNTGGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDNTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVTLQVLIPRLAVFSINQVLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDHAH
CCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPED
IVKESVSCSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRLMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAVLNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLSYDNLNHSGEDFLGTKEA
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENSNSGIIKSHYNRRTLLTPSGPEPGAQAEGTDKSDLP
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggagctctcggatgtgcactgccttagtggcagcgaggaactctacaccatccaaccg
acgcccccggccggcgacgacgggagcggctctcggccgcagcggctgctgtggcagacg
gcggtgcggcacatcaccgagcagcgcttcatccacgggcaccgaggcggcggcggcggc
ggcggcgggggctcccgcaaagcctcgaaccctgcgggcagcggacccaatcaccacacg
ccgcagctgtctaccgactcggtgctgcctctctattctctgggccccggagagcgagcg
cacaacaccggtggcaccaaagtctttcctgaacgcagcgggagcggcagtgccagtggc
agcgggggcgggggcgacttgggcttcctacaccttgactgtgccccaagtaactcagat
ttcttcctcaatggaggatacagctaccgaggggtcatttttccaaccctacgcaactcc
ttcaagtctcgggatctggagcgcctctaccaacgctatttcctgggccagaggcgcaaa
tcggaggtagtgatgaacgtgttggatgtactaaccaaactcacccttttagtcctgcac
ttgagcctggcctcggctccaatggaccctctcaagggcatcctgctaggctttttcact
ggcatcgaggtggtgatctgcgccctcgtggtggtcaggaaggacaacacctcccacact
tacctgcaatacagcggcgtggtcacttgggtggctatgaccacccagattctggcagca
ggcctgggctatgggcttctgggcgacggcataggctacgtgctttttacactcttcgcc
acctacagcatgcttcccctgcctctcacctgggccatcttggccggcctgggcacatcc
ttgctgcaagtcacccttcaagtactcatacccaggctagcggtcttttccatcaaccag
gtcctggcccaggtggtgctattcatgtgcatgaatacagcaggaatcttcatcagttac
ctttcagaccgtgcccagcgccaggccttcctggagacccggaggtgtgtggaggccagg
ctccgcctggagacagagaaccaaagacaggagcggcttgtgctgtctgtgctccccagg
tttgtcgtcctggaaatgatcaacgacatgaccaatgtggaggatgagcacctgcagcat
cagttccaccgcatctacatccatcgctatgagaacgtcagtattctttttgcagatgtc
aaaggatttaccaacctctctacgaccttgtcggctcaggagctggtcaggatgctcaac
gaactctttgccagattcgaccggctggcccatgagcatcattgtcttcgcattaaaatt
ctgggggactgctactactgtgtgtctggactgcctgagccccgccgagaccacgctcat
tgctgtgttgaaatgggcctcagcatgatcaaaactatcaggtttgtgagatccagaacg
aagcacgatgtcgacatgcgaattggaatccattcaggttctgtactatgtggtgtgttg
ggcctgaggaaatggcagtttgatgtctggtcttgggacgtggacatagcaaacaagctt
gagtctggaggaatccctgggagaattcacatttctaaagccaccctggattgcctcaat
ggtgactataatgtggaagagggtcacgggaaagagaggaacgaattcttaaggaagcat
aacatagagacctatttgattaagcagcctgaggagagtttgctctccttgcctgaagac
atagttaaggagtcggtgagttgctcagacaggagaaacagtggggcaacattcacagaa
ggatcgtggagcccagagctgcctttcgacaacatcgtgggcaaacagaatactctggct
gccctaacaagaaattcaataaatctgcttccaaaccatctcgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagagcataccatcgacttgcggagtggc
gataagttgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggatgaagtattcaagtcaaacttggtctgtgcattt
atcgttcttctgtttatcactgcaattcaaagtttgcttccttcttcgaggctgatgcct
atgactatccagttctccatcctgatcatgctgcactctgccctggtcctcatcaccaca
gcagaagactataagtgtctgcccctcatcctccgcaaaacctgctgttggattaatgag
acctatctggcccgcaacgtcatcatctttgcttccatcttgatcaacttcctgggagct
gtcctaaatattctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcactggg
gtgttagccatggtcacctgtgctgtatttctacggcttaactctgtcctgaagctggca
gtgctactcatcatgatcgccatctacgccctgctgacagagaccatctacgcaggtctc
tttctgagttatgacaacctgaaccacagtggagaagatttcctgggtaccaaggaagca
tcactgctgctgatggccatgttccttcttgctgtgttctaccatggacaacagctggag
tacacagcccgcctggatttcctgtggcgcgtacaggccaaagaggagatcaacgagatg
aaggaactgagggaacacaacgagaacatgctgcgcaatatcttacccagccacgtggcc
cgccacttcctggagaaagacagagacaatgaggagctgtattctcaatcctatgatgct
gttggggtgatgttcgcctccatccctggattcgcagacttctactctcagacagaaatg
aacaaccagggggtggaatgtctgcgcttgctgaatgagatcattgctgactttgatgag
ctgctcggggaggaccggtttcaggacattgagaagattaagaccattggtagtacgtac
atggctgtctcaggactgtccccagagaaacagcaatgtgaagataaatggggccatttg
tgtgccctggctgacttctctcttgctctgactgaaagcatacaagagatcaacaagcat
tcgttcaacaattttgaactccgaatcggcatcagccacggctcagtggtagcaggtgta
attggagctaagaaaccacagtatgacatttggggaaaaactgtgaacttggcaagccga
atggacagcacgggagtaagtggccggatccaagttcctgaggagacctaccttatcctg
aaggaccagggctttgcctttgactaccgtggggagatatatgtgaagggcatcagtgaa
caagaagggaaaatcaaaacgtactttctcctgggacgagtccaacccaacccattcatc
ttacccccaaggagacttcccgggcaatattctctggctgcagttgtccttggccttgtc
cagtctctcaataggcaaaggcagaagcaacttctcaacgagaacagcaattcgggcatc
atcaagagccattacaaccggcggactttgctaacgccaagtgggccagagcctggagca
caagctgaaggcactgacaaatccgatttgccataa

KEGG   Mus caroli (Ryukyu mouse): 110311373
Entry
110311373         CDS       T05910                                 

Gene name
Adcy5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05012  Parkinson disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05032  Morphine addiction
mcal05034  Alcoholism
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110311373 (Adcy5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110311373 (Adcy5)
   04371 Apelin signaling pathway
    110311373 (Adcy5)
   04072 Phospholipase D signaling pathway
    110311373 (Adcy5)
   04024 cAMP signaling pathway
    110311373 (Adcy5)
   04022 cGMP-PKG signaling pathway
    110311373 (Adcy5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110311373 (Adcy5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110311373 (Adcy5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110311373 (Adcy5)
   04062 Chemokine signaling pathway
    110311373 (Adcy5)
  09152 Endocrine system
   04911 Insulin secretion
    110311373 (Adcy5)
   04923 Regulation of lipolysis in adipocytes
    110311373 (Adcy5)
   04912 GnRH signaling pathway
    110311373 (Adcy5)
   04913 Ovarian steroidogenesis
    110311373 (Adcy5)
   04915 Estrogen signaling pathway
    110311373 (Adcy5)
   04914 Progesterone-mediated oocyte maturation
    110311373 (Adcy5)
   04921 Oxytocin signaling pathway
    110311373 (Adcy5)
   04926 Relaxin signaling pathway
    110311373 (Adcy5)
   04935 Growth hormone synthesis, secretion and action
    110311373 (Adcy5)
   04918 Thyroid hormone synthesis
    110311373 (Adcy5)
   04928 Parathyroid hormone synthesis, secretion and action
    110311373 (Adcy5)
   04916 Melanogenesis
    110311373 (Adcy5)
   04924 Renin secretion
    110311373 (Adcy5)
   04925 Aldosterone synthesis and secretion
    110311373 (Adcy5)
   04927 Cortisol synthesis and secretion
    110311373 (Adcy5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110311373 (Adcy5)
   04270 Vascular smooth muscle contraction
    110311373 (Adcy5)
  09154 Digestive system
   04970 Salivary secretion
    110311373 (Adcy5)
   04971 Gastric acid secretion
    110311373 (Adcy5)
   04972 Pancreatic secretion
    110311373 (Adcy5)
   04976 Bile secretion
    110311373 (Adcy5)
  09156 Nervous system
   04724 Glutamatergic synapse
    110311373 (Adcy5)
   04727 GABAergic synapse
    110311373 (Adcy5)
   04725 Cholinergic synapse
    110311373 (Adcy5)
   04728 Dopaminergic synapse
    110311373 (Adcy5)
   04726 Serotonergic synapse
    110311373 (Adcy5)
   04723 Retrograde endocannabinoid signaling
    110311373 (Adcy5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110311373 (Adcy5)
  09149 Aging
   04211 Longevity regulating pathway
    110311373 (Adcy5)
   04213 Longevity regulating pathway - multiple species
    110311373 (Adcy5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110311373 (Adcy5)
   04714 Thermogenesis
    110311373 (Adcy5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311373 (Adcy5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110311373 (Adcy5)
  09165 Substance dependence
   05030 Cocaine addiction
    110311373 (Adcy5)
   05031 Amphetamine addiction
    110311373 (Adcy5)
   05032 Morphine addiction
    110311373 (Adcy5)
   05034 Alcoholism
    110311373 (Adcy5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110311373 (Adcy5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110311373 (Adcy5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110311373 (Adcy5)
   05163 Human cytomegalovirus infection
    110311373 (Adcy5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110311373 (Adcy5)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110311373 (Adcy5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 110311373
NCBI-ProteinID: XP_021040289
Ensembl: MGP_CAROLIEiJ_G0020700
UniProt: A0A6P5R5W7
LinkDB
Position
16
AA seq 1262 aa
MSGSKSVSPPGYAAQTAASPAPRGGPEHRAAWGEADSRANGYPHAPGGSTRGSTKRSGGA
VTPQQQQRLASRWRGGDDDEDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDGGRGSRRQR
RGAAAGGSTRAPPAGGSGSSAAAAAAAGGTEVRPRSVELGLEERRGKGRAAEELEPGTGT
VEDGDGSEDGGSSVASGSGTGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARPPLQIAYLAVLAAAVGVILIMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLAISLHTNSQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGDRNAYLKEHSIETFLILSCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITMVPRSLFMLSFYLSCFLLLALVVFVSVIYACVKLFPTPLQTLSRKIVRSKKNSTLVGV
FTITLVFLSAFVNMFMCNSKNLVGCLAEEHNITVNQVNACHVMESAFNYSLGDEQGFCGS
PQPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIEFIYVLIVEVPGVTLFDNAD
LLVTANAVDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKAGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
LS
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgctgcacagacagcggcgtcgccg
gcgccccggggaggcccggaacatcgcgccgcttggggagaagccgactcccgcgccaat
ggctacccccacgcccccgggggatctacccgcggctccaccaagagatctgggggagcg
gtgaccccacaacagcagcagcgcctggccagccgatggcgcggtggcgacgacgacgaa
gaccctccactaagcggtgatgaccctctggctgggggcttcggcttcagcttccgctct
aagtccgcctggcaggagcgcggtggcgacgacggcggtcgcggcagcaggcggcagcga
cggggcgcggctgcagggggcagcacccgggcgccccctgcgggcggcagcggcagttcg
gcggcggccgcagcggccgcaggtggcacagaggtgcgcccccgctcggtggagctgggc
ctggaggagcgtcgaggaaaaggccgcgcggccgaggagctggagcccgggactggcacc
gtcgaggatggagacgggtcggaggatggaggcagttctgtggcgtcaggctctgggacc
ggcgcggtgctgtccttgggcgcctgctgcctggccttgctgcagatattccgctctaag
aaattcccgtcggacaaactggagcgtctgtaccagcgctacttcttccgcctgaaccag
agcagtctcaccatgctcatggccgtgctggtgctcgtgtgcctggtcatgctggctttc
cacgcggcgcggcccccgctccagatagcctacctggccgtgttggcagctgctgtaggt
gtgatccttatcatggccgtgctctgcaaccgtgcagcgttccaccaggaccacatgggc
ctggcctgctatgcgctcattgcagtggtgctggccgtccaggtagtgggcctgttgctg
ccacagccacgcagcgcctccgagggcatctggtggaccgtgttcttcatctataccatc
tacaccctgctgcctgtgcgcatgagggctgcggtgctcagcggggtgcttctgtcggct
ctccacttggccatctctctgcacaccaactcccaggaccagtttctgctgaaacagctt
gtctccaatgtcctcatcttctcctgcaccaacattgtgggtgtgtgcactcactaccca
gctgaggtctcccagagacaggccttccaggagacccgggagtgtatccaggctcggctc
cattcccagcgggagaaccagcaacaggagcgtctcctgctgtctgtccttccccgtcat
gttgccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccacaag
atctacatccagaagcatgacaatgtgagcatcctgtttgctgacatcgagggcttcacc
agcctggcttcccagtgtactgcccaagaactggtcatgaccctcaacgagctcttcgcc
cgctttgacaagttggctgcggagaatcactgtttacgaattaagatcctcggggattgt
tactactgtgtctcggggctgcctgaagccagagccgaccacgcccactgctgcgtggag
atgggaatggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaacgtg
aacatgcgtgtgggaattcacagcgggagagtacactgcggtgtccttggtctcagaaag
tggcaattcgacgtgtggtctaacgatgtcactctggccaaccacatggaagctggtggc
aaggcaggccgcatccacatcaccaaggccacactcaactacctgaatggggactatgag
gtggagccaggctgtggtggcgatcgcaatgcctacctcaaggagcacagcattgagacc
ttcctcatcctgagctgtacccagaagcggaaagaagagaaggccatgatcgccaagatg
aaccgccagagaaccaactccatcggacacaatccgcctcactggggagccgagcgcccc
ttctacaaccacttgggcggcaaccaggtgtccaaggagatgaagaggatgggctttgag
gaccccaaggacaagaatgcacaggaaagtgcgaacccagaggatgaagtggacgagttt
ctgggtcgggccatcgatgccaggagcatcgacagactgcgatctgaacacgtccgcaag
ttcctcctgaccttcagggagcctgacttagagaagaagtattccaagcaggtggatgac
cgatttggtgcctatgtggcctgcgcctcgcttgttttcctcttcatctgctttgtccag
atcaccatggtgccccgctccctgttcatgctgagtttctacctgtcgtgtttcctgctg
ctggccttggtggtgtttgtgtctgtgatctacgcctgtgtgaagctcttccccactccc
ctgcagacactctccaggaagatagtgcgatccaagaagaacagcaccctggtcggggta
ttcaccatcaccctggtgttcctctcggcttttgtcaacatgttcatgtgcaactctaag
aacttggtgggctgcctggcagaggagcacaacatcacggtgaaccaggtcaacgcatgc
catgtgatggagtcggccttcaactacagcctgggcgacgagcagggcttctgtggcagc
ccccagcccaactgcaacttcccagagtacttcacctacagcgtgctgctcagcctgctg
gcctgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatt
gagtttatctacgtgctcatcgtggaggtgcccggcgtcacactcttcgacaacgctgac
cttcttgtcaccgccaatgccgtagacttcagcaacaacgggacctcccagtgccctgag
catgcgaccaaggtggcgctgaaggtggtgacgcccatcatcatctctgtcttcgtgctg
gctctgtatctgcatgcccagcaggtggagtccactgctcgccttgacttcctctggaaa
ctgcaggccacagaagagaaggaggagatggaggagctgcaggcctacaaccggcgcctg
ctgcacaacattctgcccaaggacgtggctgcccacttcctggcccgggaacggcgcaat
gatgagctgtactaccaatcgtgcgagtgtgtggctgtcatgtttgcctccattgccaac
ttctccgaattctatgtggagctagaggccaacaatgagggcgtcgagtgcctacggctg
ctcaatgagatcattgcagacttcgatgagatcatcagtgaggatcggttcaggcagctg
gaaaagatcaagaccataggcagcacctacatggctgcctctggcctcaatgactccacc
tatgacaaggcaggcaagacccacatcaaggctcttgcagacttcgctatgaagctgatg
gaccaaatgaagtacatcaatgagcactccttcaacaacttccagatgaagattgggctc
aacattggacctgtagtggctggagtcattggggctcgcaagcctcagtatgacatctgg
ggcaatacagtgaatgtggccagccgtatggacagcactggggtgcctgaccgcatccag
gttactacagatatgtaccaggtgctggccgccaacacataccagctggagtgccggggt
gtggtcaaggtcaagggcaagggtgagatgatgacttacttcctcaatggagggcctccc
ctcagttag

KEGG   Mus caroli (Ryukyu mouse): 110311555
Entry
110311555         CDS       T05910                                 

Gene name
Adcy9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00230  Purine metabolism
mcal01100  Metabolic pathways
mcal01522  Endocrine resistance
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04713  Circadian entrainment
mcal04714  Thermogenesis
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04727  GABAergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04918  Thyroid hormone synthesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal04962  Vasopressin-regulated water reabsorption
mcal04970  Salivary secretion
mcal04971  Gastric acid secretion
mcal04972  Pancreatic secretion
mcal04976  Bile secretion
mcal05032  Morphine addiction
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110311555 (Adcy9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110311555 (Adcy9)
   04371 Apelin signaling pathway
    110311555 (Adcy9)
   04020 Calcium signaling pathway
    110311555 (Adcy9)
   04072 Phospholipase D signaling pathway
    110311555 (Adcy9)
   04024 cAMP signaling pathway
    110311555 (Adcy9)
   04022 cGMP-PKG signaling pathway
    110311555 (Adcy9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110311555 (Adcy9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110311555 (Adcy9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110311555 (Adcy9)
   04062 Chemokine signaling pathway
    110311555 (Adcy9)
  09152 Endocrine system
   04911 Insulin secretion
    110311555 (Adcy9)
   04923 Regulation of lipolysis in adipocytes
    110311555 (Adcy9)
   04912 GnRH signaling pathway
    110311555 (Adcy9)
   04913 Ovarian steroidogenesis
    110311555 (Adcy9)
   04915 Estrogen signaling pathway
    110311555 (Adcy9)
   04914 Progesterone-mediated oocyte maturation
    110311555 (Adcy9)
   04921 Oxytocin signaling pathway
    110311555 (Adcy9)
   04926 Relaxin signaling pathway
    110311555 (Adcy9)
   04935 Growth hormone synthesis, secretion and action
    110311555 (Adcy9)
   04918 Thyroid hormone synthesis
    110311555 (Adcy9)
   04928 Parathyroid hormone synthesis, secretion and action
    110311555 (Adcy9)
   04916 Melanogenesis
    110311555 (Adcy9)
   04925 Aldosterone synthesis and secretion
    110311555 (Adcy9)
   04927 Cortisol synthesis and secretion
    110311555 (Adcy9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110311555 (Adcy9)
   04270 Vascular smooth muscle contraction
    110311555 (Adcy9)
  09154 Digestive system
   04970 Salivary secretion
    110311555 (Adcy9)
   04971 Gastric acid secretion
    110311555 (Adcy9)
   04972 Pancreatic secretion
    110311555 (Adcy9)
   04976 Bile secretion
    110311555 (Adcy9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110311555 (Adcy9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110311555 (Adcy9)
  09156 Nervous system
   04724 Glutamatergic synapse
    110311555 (Adcy9)
   04727 GABAergic synapse
    110311555 (Adcy9)
   04725 Cholinergic synapse
    110311555 (Adcy9)
   04723 Retrograde endocannabinoid signaling
    110311555 (Adcy9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110311555 (Adcy9)
  09149 Aging
   04211 Longevity regulating pathway
    110311555 (Adcy9)
   04213 Longevity regulating pathway - multiple species
    110311555 (Adcy9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110311555 (Adcy9)
   04714 Thermogenesis
    110311555 (Adcy9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311555 (Adcy9)
  09165 Substance dependence
   05032 Morphine addiction
    110311555 (Adcy9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    110311555 (Adcy9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110311555 (Adcy9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110311555 (Adcy9)
   05163 Human cytomegalovirus infection
    110311555 (Adcy9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110311555 (Adcy9)
Enzymes [BR:mcal01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110311555 (Adcy9)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 DUF512 AC_N zf-C2HC_2
Other DBs
NCBI-GeneID: 110311555
NCBI-ProteinID: XP_021040591
Ensembl: MGP_CAROLIEiJ_G0020399
UniProt: A0A6P5R731
LinkDB
Position
16
AA seq 1353 aa
MASSPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNTHPKHCKYSISSSCSSSGDS
GGLPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSMNLEEACLERCFPQTQRRFRYAL
FYVGFACLLWSIYFAVHMRSKVIVMVVPALCFLVVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVWTPLSGRVDSSNHTLTATPADTCLSQVGSFSICIEVLFLLYTVMHL
PLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGALHWELLSRALLHVCIHAIGIHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGRVIERLGQSVVADQLKGLKTYLISGQRAKESHCSCAEALLSGFEVIDDSRES
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAVQNGCQDEPKT
STKASGGPSSKTQNGLLSPPAEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSVTCFLKYGATATPPPPAALAVFGADLLLEVLSLIVSIR
MVFFLEDVMTCTKWLLEWIAGWLPRHCIGAILVSLPALAVYSHITSEFETNIHVTMFTGS
AVLVAVVHYCNFCQLSSWMRSSLATIVGAGLLLLLHISLCQDSSIVMSPLDSAQNFSAQR
NPCNSSVLQDGRRPASLIGKELILTFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCMDNGVVPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYSDKASLGSDDSTQAKEAHPSSKRPWKEPVKAEE
RFPFGKAIEKDNCEDIGVEEANELTKLNVSKSV
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcttcctcaccccaccagcagctgctgcatcaccatagcaccgaggtgagctgcgac
tcaagcggagacagcaacagcgtgagggtcaagatcaaccctaagcagctgtcctccaac
acccacccgaagcactgcaagtacagcatctcctccagctgtagcagctcgggagactca
gggggccttccccggagggttggcggcgggggtcgcctgcgcagacagaagaagctgccc
cagctttttgagagggcctccagccggtggtgggaccccaaatttgactccatgaacctg
gaggaggcctgcctggagcgctgctttccgcagacccagcgccgcttccggtacgcactc
ttttatgtgggcttcgcctgccttctctggagcatctatttcgctgtccacatgagatcc
aaagtgattgtcatggtggtcccggctctatgcttcctggtggtgtgtgtgggctttttc
ctgtttactttcaccaagctgtacgcccggcattatgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagtttcaggtttggacacctctgtcagga
cgtgttgacagctccaatcatactctcacggccactccggcggacacttgcttatctcaa
gttggaagcttctccatatgcatcgaagtgctctttttgctctacacagtcatgcattta
cctctgtacctgagcttgtttttgggggtggtctattctgtcctttttgagacctttggc
taccatttccgaaacgaagactgctacccttccccgggccctggggccctgcactgggag
ctgctgagcagagccctgcttcacgtgtgcattcacgctatcgggatccatctgtttgtc
atgtctcaggtgaggtccaggagcacctttctcaaggtgggacaatccattatgcacggc
aaagatctggaagtagagaaagccctgaaagaaaggatgattcattcagtgatgccaaga
atcatagctgacgacttaatgaaacaaggggacgaggagagtgagaattccgtcaagagg
catgccacctccagtcccaagaacaggaagaagaagtcctccatacagaaggcaccgata
gcattccgcccctttaagatgcagcagattgaagaagtcagtattttatttgcagacatt
gtgggtttcaccaagatgagcgccaacaaatctgctcatgccttggtaggtctactcaat
gatctgtttggtcgctttgaccgcttgtgtgaggagaccaagtgtgagaagatcagcact
ctgggagactgttactattgtgtggcagggtgtccggagccccgggcagaccatgcctac
tgctgcattgaaatgggcttaggcatgataaaagccatcgagcagttctgccaggagaag
aaagagatggtgaacatgcgtgttggggttcacacggggactgtcctgtgtggcatcctg
ggcatgaggaggtttaaatttgatgtgtggtccaacgatgtgaacttggctaatctcatg
gagcagctgggagtggctggcaaagttcacatatctgaggccactgcaaaatacttagac
gacaggtatgaaatggaagatgggagagttattgagcgccttgggcagagtgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtcccac
tgcagctgtgcagaggccctgctttctggctttgaggtcattgacgactcacgggagtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgatttggcgcagact
gtcaaaacctttgataaccttaagacttgcccttcttgtggaatcacatttgctcccaaa
tctgaagctggtgcagaaggaggagctgtgcaaaatggctgtcaagacgagcctaagacc
agcaccaaggcttctggaggacccagctccaaaacccagaacggacttctgagccctcct
gcagaggagaagctcactaacagccagacctccctctgtgagatcctgcaagagaagggg
cggtgggcaggcgtgagcttggaccagtcagccctcctcccgctcaggttcaagaacatc
cgtgagaaaacggatgcccactttgttgatgtcatcaaagaagacagcctgatgaaagat
tatttcttcaagccgcccatcaatcagttcagcctgaacttcctggaccaggagctggag
cgatcatatagaaccagctaccaggaagaggtcataaagaattctcctgtgaagacgttc
gccagtgccaccttcagctcgcttctggatgtgtttctgtcaaccacagtgttcctgatt
ctctctgtcacctgcttcctaaagtatggagccacagccacccctcccccaccagctgcc
ctggccgtctttggtgcagacctgctgctggaggtgctttccctcatagtgtccatcaga
atggtgtttttcctagaggatgtcatgacatgcacaaagtggttgctggaatggattgct
ggctggctccctcgccactgcattggggcaatcttggtgtctcttcctgccctggctgtc
tattcacacatcacctctgagtttgagaccaacatacatgtcaccatgttcactggctct
gcggtgctggtagccgttgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccctcgccaccatcgtgggggctgggctgctgcttctgctccacatctccctgtgt
caggacagttccattgtgatgtcccccttggactcagcacagaatttcagtgcccagagg
aacccatgcaacagctcagtgctgcaggacggcaggaggccggccagcctcataggcaag
gagctcatcctcaccttcttcctcctgctcctcttggtctggttcctgaaccgggagttc
gaggtcagctaccggctgcactaccatggggatgtggaggccgacctacaccgcaccaag
atccagagcatgagagaccaggctgactggctactgcggaacatcatcccctaccacgtg
gctgagcagctcaaggtctctcagacctactccaagaaccatgacagcgggggagtcatc
tttgccagtattgtcaacttcagtgaattctatgaggagaactatgaggggggcaaggag
tgctaccgtgtcctcaacgagctgatcggtgacttcgatgagctcttgagcaagccagac
tataatagcatcgagaagatcaagaccattggggccacatacatggcagcctcagggctg
aacacggcccagtgtcaggagggtggccacccacaggagcatctgcgtatcctcttcgag
ttcgccaaggagatgatgcgggtggtggatgacttcaacaacaatatgttatggttcaac
ttcaagctcagggtcggctttaaccacggacccctcacggcaggtgtcataggtaccacc
aagctgctgtatgacatctggggggacactgtcaacatcgccagcaggatggacaccact
ggtgtggagtgccgtatccaggtgagtgaagagagctaccgtgtgctgagcaagatgggt
tatgactttgactaccgagggaccgtgaatgtcaaggggaaagggcagatgaagacctac
ctttacccaaagtgcatggacaatggagtggttccccagcaccagctgtccatctcccca
gacatccgtgtccaggtggacggcagcattggacggtctcccacagatgagattgccaac
ttggtgccttccgttcagtattcggacaaggcttccctgggatctgatgacagtacgcag
gctaaggaagcacacccgtcctctaagaggccctggaaagagccagtcaaagcagaggaa
aggtttccatttggcaaagccatagaaaaggacaactgtgaagacataggagtagaagag
gccaatgaactcaccaagctcaacgtctcaaagagtgtgtga

DBGET integrated database retrieval system