KEGG   Mus caroli (Ryukyu mouse): 110299753
Entry
110299753         CDS       T05910                                 

Gene name
Smad1
Definition
(RefSeq) mothers against decapentaplegic homolog 1
  KO
K04676  mothers against decapentaplegic homolog 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110299753 (Smad1)
   04390 Hippo signaling pathway
    110299753 (Smad1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110299753 (Smad1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110299753 (Smad1)
SSDB
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Other DBs
NCBI-GeneID: 110299753
NCBI-ProteinID: XP_021025214
Ensembl: MGP_CAROLIEiJ_G0031249
UniProt: A0A6P7R5I0
LinkDB
Position
8
AA seq 465 aa
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQ
PMDTNMMAPPLPAEISRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaatgtgaccagcttgttttcattcacaagtccagctgtgaagagactccttgggtgg
aaacagggcgatgaagaagagaaatgggcagagaaagctgtggatgctttggtgaagaaa
ctgaagaagaagaaaggggccatggaagagctggagaaggccctgagctgccctggacag
ccgagtaactgcgtcaccattcctcgctccctggatggcaggttgcaggtgtcccaccgg
aagggactacctcatgtcatttattgccgtgtgtggcgctggcccgacctccagagccac
catgaactgaagcctctggaatgctgtgagttcccatttggttccaagcagaaggaggtc
tgcatcaacccctaccactataagcgagtggagagcccggttctcccgccagtgctggtt
ccgaggcacagcgagtacaatcctcagcacagccttctggctcagttccgcaacctggga
caaaatgagcctcacatgccactgaacgccacgttcccagactctttccagcagcccaac
agccacccgttcccccactcccccaacagcagctaccccaactctcctggcggcagcagc
agcacctaccctcactccccgaccagctcagacccaggcagcccttttcagatgccagct
gacacacctccacctgcttacctgcctcctgaagaccccatggcccaggatggctctcag
cccatggacacgaacatgatggcacctccactgcccgctgaaatcagcagaggagatgtt
caggcagttgcttacgaggaaccaaaacactggtgctctattgtgtactatgagctcaac
aaccgtgtgggtgaagcgttccacgcctcgtccaccagcgtgttggtggatggtttcaca
gatccgtccaacaataagaaccgcttctgccttggcttgctctccaacgttaaccggaac
tccactattgaaaacaccaggcgacatatcgggaaaggagtccacctttattacgttgga
ggagaggtatatgcggaatgcctcagtgacagcagcatcttcgtgcagagccggaactgc
aactaccaccacggctttcatcccaccaccgtctgcaagatccccagcgggtgcagcttg
aaaatcttcaacaaccaagagtttgctcagctactggcgcagtctgtgaaccacgggttc
gagacagtgtatgaactcaccaaaatgtgcactattcgaatgagcttcgtgaagggctgg
ggagccgaataccaccggcaggatgttaccagcaccccctgctggattgagatacatctg
catggccctctccagtggctggataaggttcttacccagatgggttcaccccacaatcct
atttcatccgtgtcttaa

DBGET integrated database retrieval system