KEGG   Mus caroli (Ryukyu mouse): 110299930
Entry
110299930         CDS       T05910                                 

Gene name
Itgb1
Definition
(RefSeq) integrin beta-1
  KO
K05719  integrin beta 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04145  Phagosome
mcal04151  PI3K-Akt signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal04514  Cell adhesion molecules
mcal04530  Tight junction
mcal04611  Platelet activation
mcal04670  Leukocyte transendothelial migration
mcal04810  Regulation of actin cytoskeleton
mcal05100  Bacterial invasion of epithelial cells
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05145  Toxoplasmosis
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05222  Small cell lung cancer
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110299930 (Itgb1)
   04151 PI3K-Akt signaling pathway
    110299930 (Itgb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110299930 (Itgb1)
   04514 Cell adhesion molecules
    110299930 (Itgb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110299930 (Itgb1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110299930 (Itgb1)
   04530 Tight junction
    110299930 (Itgb1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110299930 (Itgb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110299930 (Itgb1)
   04670 Leukocyte transendothelial migration
    110299930 (Itgb1)
  09158 Development and regeneration
   04360 Axon guidance
    110299930 (Itgb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110299930 (Itgb1)
   05205 Proteoglycans in cancer
    110299930 (Itgb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110299930 (Itgb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110299930 (Itgb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110299930 (Itgb1)
   05414 Dilated cardiomyopathy
    110299930 (Itgb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110299930 (Itgb1)
   05133 Pertussis
    110299930 (Itgb1)
   05100 Bacterial invasion of epithelial cells
    110299930 (Itgb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110299930 (Itgb1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110299930 (Itgb1)
   05140 Leishmaniasis
    110299930 (Itgb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110299930 (Itgb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110299930 (Itgb1)
   04515 Cell adhesion molecules [BR:mcal04515]
    110299930 (Itgb1)
   04090 CD molecules [BR:mcal04090]
    110299930 (Itgb1)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110299930 (Itgb1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110299930 (Itgb1)
Cell adhesion molecules [BR:mcal04515]
 Integrins
  Integrin beta subunits
   110299930 (Itgb1)
CD molecules [BR:mcal04090]
 Proteins
  110299930 (Itgb1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 110299930
NCBI-ProteinID: XP_021025557
Ensembl: MGP_CAROLIEiJ_G0031735
UniProt: A0A6P5Q1D3
LinkDB
Position
8
AA seq 798 aa
MNLQLVSWIGLISLICSVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPT
SARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLL
LKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTGPCL
ASNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDDCWFYFTYSVNGNNEAIVHVVET
PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttgcaactggtttcctggattggcttgatcagtttgatttgttctgtatttggc
caaacagataaaaatagatgtttaaaagcaaatgccaaatcttgcggagaatgtatacaa
gcagggccaaattgtgggtggtgtacaaatacgacatttttgcaagaaggaatgcctact
tctgcacgatgtgatgatttagaagctttgaaaaagaagggttgccagccaagtgacata
gagaatcccagaggctcccaaactataaagaaaaataaaaatgtcaccaatcgcagcaaa
gggatggcagagaagctccggccggaagacattactcagatccaaccacagcagctgctt
ctaaaattgagatcaggagaaccacagaagtttacattaaaattcaagagggctgaagac
taccctattgatctctactaccttatggatctctcctactctatgaaagatgatctggag
aatgtgaaaagtcttgggacggatttgatgaatgaaatgaggaggattacttcagacttc
cgcattggctttggctcatttgtggagaaaactgtgatgccgtatattagcacaacccca
gcaaagctaagaaatccttgtacaagtgaacaaaactgcaccagcccatttagctacaaa
aatgtgcttagtcttactgacagaggagagtttttcaatgaacttgttggtcagcagcgc
atatctggaaacttggattctccagaaggtggttttgatgcaatcatgcaggttgcggtt
tgtggatcgctgattggctggaggaatgtaacacgactgctggtgttttccacggatgct
gggtttcactttgctggagatgggaaacttggtggtattgttttacccaatgatggacaa
tgtcacctggaaaataatgtatatacaatgagccattactatgattatccttcaattgct
caccttgttcagaaactaagtgaaaataatattcagacgatttttgcagttactgaagag
ttccaacctgtttacaaggaattgaagaatttgattcctaagtcagcagtgggcacactg
tctggaaactctagtaatgtgatccagctaatcatcgatgcctacaactctctttcttca
gaagtcattctggaaaatagcaaattgccagacggagtaacaataaattacaaatcctac
tgcaagaatggggtgaatgggacaggagaaaatggacgaaagtgttccaacatttccatt
ggagatgaggttcaatttgaaattagcataactgctaataaatgtccaaataaggagtct
gaaaccattaaaattaaacctctgggcttcactgaagaagtagaggttgttcttcagttc
atctgtaagtgcaattgccaaagccatggcatcccagcaagtcccaagtgccatgaggga
aatggcacatttgagtgtggagcctgcaggtgcaatgaggggcgtgttgggaggcactgt
gaatgtagcacagatgaagtgaacagtgaagacatggacgcttactgcaggaaagagaac
agttcggaaatctgcagtaacaatggagaatgtgtctgtggacagtgtgtgtgtaggaag
agagataatacaaatgaaatttactctggcaaattctgcgagtgtgataacttcaactgt
gacaggtctaatggcttaatttgtggaggcaatggtgtgtgcaggtgtcgtgtttgtgaa
tgctatcccaattacactggaagtgcatgtgactgttctttggacactggtccatgtcta
gcgtcaaatggtcagatctgcaatggccggggtatttgtgaatgtggcgcttgtaagtgc
acagatcccaagtttcaagggccaacttgtgagacctgtcagacctgccttggcgtctgt
gcagagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacacg
tgtgcacaggagtgctcccacttcaatctcaccaaagtagaaagcagggagaagttgccc
cagccggtgcaggtcgatcctgtgacccattgcaaggagaaggacattgatgactgctgg
ttctatttcacctattcagtgaatggcaacaatgaagctatcgtgcatgttgtggagact
ccagactgtcctactggtcccgacatcatcccaattgtagcaggcgtggttgctggaatt
gttcttattggccttgccttgctgctgatttggaaacttttaatgataattcatgacaga
agggaatttgctaaatttgaaaaggagaaaatgaatgccaagtgggacacgggtgaaaat
cctatttacaagagtgccgtgacaactgtggtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system