KEGG   Mus caroli (Ryukyu mouse): 110299983
Entry
110299983         CDS       T05910                                 

Gene name
Slc45a3
Definition
(RefSeq) solute carrier family 45 member 3
  KO
K15379  solute carrier family 45, member 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05202  Transcriptional misregulation in cancer
mcal05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110299983 (Slc45a3)
   05206 MicroRNAs in cancer
    110299983 (Slc45a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110299983 (Slc45a3)
Transporters [BR:mcal02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   110299983 (Slc45a3)
SSDB
Motif
Pfam: MFS_1 MFS_2 DUF553 MFS_1_like
Other DBs
NCBI-GeneID: 110299983
NCBI-ProteinID: XP_021025641
Ensembl: MGP_CAROLIEiJ_G0014578
UniProt: A0A6P5Q7B2
LinkDB
Position
1
AA seq 553 aa
MIQRLWASRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
PVLGLVSVPLLGSASDQWRGRYGRRRPFIWALSLGVLLSLFLIPRAGWLAGLLCPDTRPL
ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAFSVYAFMISLGGCLGYLLPA
IDWDTSALAPYLGTQEECLFGLLTFIFLICMAATLFVTEEAVLGPPEPAEGLLVSAVSRR
CCPCHVGLAFRNLGALFPRLQQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL
YQGVPRAEPGTEARRHYDEGIRMGSLGLFLQCAISLVFSLVMDRLVQKFGTRSVYLASVM
TFPVAAAATCLSHSVVVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDAGG
SSSEDSQTTSFLPGPKPGAPFPNGHMGSGSSGILVPPPALCGASACDVSMRVVVGEPPEA
RVVTGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSHSVTAYMVSAAGLGLVAIYFATQ
VVFDKNDLAKYSV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgatccagaggctatgggccagccgtctgctacggcaccggaaagctcaactcctgctg
gtcaacctgctcacctttggcctggaggtgtgcctggctgccggcattacctatgtgcca
ccccttctgctggaagtcggggtagaggagaaattcatgaccatggtgttgggcattggt
ccagtgttaggcctggtttctgttccactcctaggctcagccagtgaccagtggcgtggg
cgctatggccgccggagaccctttatctgggctctgtccctgggtgtcctgctaagcctc
tttctcatcccgagggctggctggctggcagggctgctgtgcccagacaccaggcccctg
gagttggccctgctgatcttgggagtggggctgctggacttttgtggccaggtgtgcttc
actccattggaggccttactctccgacctcttccgggacccagaccactgtcgccaagcc
ttctctgtctacgccttcatgatcagccttgggggctgcctgggctacctcttacctgcc
attgactgggacaccagcgctctggccccctacctgggtactcaggaagaatgcctcttc
ggcctcctcaccttcattttcctcatctgcatggcagccactctgtttgtgacagaggag
gcagtactgggcccgcccgagccggcagaagggttgttggtctctgccgtgtcacgccga
tgctgcccatgccacgttggcctggctttccggaatctgggtgccctgtttccccggctg
cagcagctgtgctgccgcatgcctcgcaccctacgccggctctttgtggctgagctgtgc
agctggatggcacttatgacttttacactgttctacacggacttcgtgggagaggggctg
taccagggtgtacccagagccgagccaggcaccgaagcccggagacactatgatgaaggc
attcgaatgggcagcctggggctcttcctgcagtgtgccatctccctggtcttctccctg
gtcatggacaggctggtacagaagttcggcacacggtcagtctatctggccagtgtgatg
acctttcctgtggctgccgctgccacctgcctgtcccacagcgtggtggtcgtgacagcc
tcagctgccctcaccgggttcaccttctcggccttgcagatcctgccttacacgctcgcc
tccctctaccaccgtgagaagcaggtgttcctgcccaaatacagaggggacgctggaggt
agcagcagtgaggacagccagacaaccagcttcttgccaggccctaagccaggagctccc
ttccccaatggacacatgggctctggcagcagcggcatcctggtccctccacctgcactc
tgtggggcctctgcctgcgatgtctccatgcgagtggtggtgggtgagccacctgaggcc
agggttgttacgggacggggcatttgcctggacttggccatcctagacagtgcctttctg
ctgtcccaggtggctccgtccctgttcatgggctccattgtccagctgagccactctgtc
actgcctatatggtatcagctgcaggcttgggtctggtcgccatttactttgctacacag
gtagtgtttgacaagaacgacttggccaaatactcagtgtag

DBGET integrated database retrieval system