KEGG   Mus caroli (Ryukyu mouse): 110300050
Entry
110300050         CDS       T05910                                 

Gene name
Hhip
Definition
(RefSeq) hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04024  cAMP signaling pathway
mcal04340  Hedgehog signaling pathway
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110300050 (Hhip)
   04024 cAMP signaling pathway
    110300050 (Hhip)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300050 (Hhip)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110300050 (Hhip)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 110300050
NCBI-ProteinID: XP_021025762
Ensembl: MGP_CAROLIEiJ_G0031253
UniProt: A0A6P5QE09
LinkDB
Position
8
AA seq 700 aa
MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGARRRRCLNGNPPKRLKRRDRRVMSQLE
LLSGGEILCGGFYPRVSCCLQSDSPGLGRLENKIFSATNNSECSRLLEEIQCAPCSPHSQ
SLFYTPERDVLDGDLALPLLCKDYCKEFFYTCRGHIPGLLQTTADEFCFYYARKDAGLCF
PDFPRKQVRGPASNYLGQMEDYEKVGGISRKHKHNCLCVQEVMSGLRQPVSAVHSGDGSH
RLFILEKEGYVKILTPEGELFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDVRTARVFLEVAELHRKHLGGQLLFG
PDGFLYVILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGRDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGAS
SSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRVTVQP
AQPLTSDCSRLCRNGYYTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNVRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgctgaagatgctctcctttaagctgctactgctggccgtggctctgggcttctttgaa
ggagatgcgaagtttggggaaaggagcgaagggagcggagcgagaaggagaaggtgcctg
aatgggaaccccccaaagcgcctaaagagaagggacaggcgggtgatgtcccagctggag
ctgctcagtggaggagagattctgtgtggtggcttctacccacgagtatcttgctgcctg
cagagtgacagccctggattggggcgtctggagaacaagatcttttctgccaccaacaac
tcagaatgcagcaggctgctggaggagatccaatgcgctccctgctccccccattcccag
agcctcttctacacacctgaaagagatgtcctggatggggacctagcacttccgcttctc
tgcaaggactactgcaaagaattcttttatacttgccgaggccatattccagggcttctt
caaacaactgctgatgaattttgcttttactatgcaagaaaagatgctgggttatgcttt
ccagacttcccgagaaagcaagtcagaggaccagcatctaactacttgggccagatggaa
gactacgagaaagtggggggaatcagcagaaaacacaaacacaactgcctctgtgtccag
gaggtcatgagtgggctgcggcagcctgtgagtgctgtgcacagcggggatggctcccat
cggctcttcattctagagaaggaaggctacgtgaagattctaaccccagaaggagaactg
ttcaaggagccttacttggatattcacaaacttgttcaaagtggaataaagggaggagac
gaaaggggtctgctaagtctggcattccatcccaattacaagaaaaatggaaagctgtat
gtgtcttataccaccaaccaggaacggtgggccattgggcctcacgaccacattcttcgg
gttgtggaatacacagtatccaggaaaaatccccatcaagttgatgtgagaacagccagg
gtgtttctggaagttgctgagctccaccgaaagcatcttgggggacagctgctctttggt
cccgatggctttttgtacgtcatccttggggatggtatgatcacgctggatgacatggaa
gagatggatgggttaagtgacttcacaggctctgtgctgaggctggacgtggacacggac
atgtgcaatgtgccttattccataccgcggagtaaccctcacttcaacagcaccaaccag
cccccagaagtattcgcccacggcctccatgatccaggcagatgtgccgtggatcgacat
cccactgatataaacatcaatttaacaatactttgctcagattccaacgggaaaaacagg
tcatcagccagaatcctacagataataaagggaagagattatgaaagtgagccatctctt
cttgaattcaagccattcagtaacggccctttggttggtggatttgtttacagaggctgt
caatctgaaagattgtacggaagctatgtgttcggagatcgcaatgggaatttcttaacc
ctccagcaaagcccagtgaccaagcaatggcaagaaaagccgctctgtctgggtgccagc
agctcctgtcgaggctacttttcgggtcacatcttgggatttggagaagatgaattagga
gaggtttacattctatcaagcagtaagagtatgacccagactcacaatggaaaactctac
aagatcgtagaccccaaaagacctttaatgcctgaggaatgcagagtcacagttcaacct
gcccagccactgacctcggattgctcccggctctgtcgaaatggctactacacccccact
ggcaagtgctgctgcagtcccggctgggagggagacttctgcagaattgccaagtgtgag
ccagcgtgccgtcatggaggtgtctgtgtcagaccgaacaagtgcctctgtaaaaagggc
tatctcggtcctcaatgcgaacaagtggacaggaacgtccgcagagtgaccagggcaggt
atccttgatcagatcattgacatgacgtcttacttgctggatctcacaagttacattgta
tag

DBGET integrated database retrieval system