KEGG   Mus caroli (Ryukyu mouse): 110300068
Entry
110300068         CDS       T05910                                 

Gene name
Gab1
Definition
(RefSeq) GRB2-associated-binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal05100  Bacterial invasion of epithelial cells
mcal05205  Proteoglycans in cancer
mcal05211  Renal cell carcinoma
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110300068 (Gab1)
   04014 Ras signaling pathway
    110300068 (Gab1)
   04072 Phospholipase D signaling pathway
    110300068 (Gab1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110300068 (Gab1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110300068 (Gab1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110300068 (Gab1)
   05226 Gastric cancer
    110300068 (Gab1)
   05211 Renal cell carcinoma
    110300068 (Gab1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110300068 (Gab1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110300068 (Gab1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110300068 (Gab1)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   110300068 (Gab1)
SSDB
Motif
Pfam: PH PH_11 PH_8 PH_9 PH_3 PH_13
Other DBs
NCBI-GeneID: 110300068
NCBI-ProteinID: XP_021025773
Ensembl: MGP_CAROLIEiJ_G0031257
UniProt: A0A6P5QE21
LinkDB
Position
8
AA seq 695 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEDMNKWVRCICDICGFNPT
EEDPVKPLTGSSQAPVDSPFAISTAPTSSQMEASSIALPPPYQVISLPPHPDTLGLQEDP
QDYLLLINCQSKKPEPNRTHFDSAKPTSSETDCNDNVPSHQTPASSHSKHGMNGFFQQQM
MYDCPPSRLTSVSGESSLYNLPRSYSHDVLPKESPSSTEADGELYTFNTPSGTAGVEMQM
RHVSISYDIPPTPGNTYQIPRTFPESTLGQSSKLDTIPDIPPPRPPKPHPTHDRSPVETC
GVPRTASDTDSSYCIPPPAGMPPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSS
LEGFHSQYKIKSVLTAGGVSGEELDENYVPMNPNSPPRQHSGSFTEPIQEPNYVPMTPGT
FDFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPL
SEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSGE
DPNLFASNSLDGGSSPMNKPKGDKQVEYLDLDLDSGKSTPPRKQKNSGSGSSMADERVDY
VVVDQQKTLALKSTREAWTDGRQSTESETPTKNVK
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgagcggcggcgaagtggtttgctcgggatggctccgcaagtcgcccccggagaagaag
ttgaagcgttatgcgtggaagagaaggtggtttgtgttgcgcagtggccgtttgactgga
gacccggatgtcctggagtattacaaaaatgatcatgccaagaagcctatccggattatt
gatttaaatttatgtcagcaagttgatgctgggttgacattcaacaaaaaggagtttgag
aacagctatatctttgatatcaacaccatcgaccggattttctacttggtggcggatagt
gaggaagacatgaacaagtgggtccgttgtatctgtgacatctgtggcttcaatcccaca
gaagaagatcctgtgaagccgctgaccggctcctcacaagcacctgtcgattcacctttc
gctataagtacagcaccaacctccagtcagatggaagcttcttcaatcgcgctacctcct
ccttaccaggtcatcagccttccgccacacccagacaccctcggcctccaggaagatcca
caagactacctcttgctgatcaactgtcaaagcaagaagccggaacctaacagaacccac
tttgactctgccaagcccacctcttctgagacagactgcaatgacaacgtcccttcccac
cagactcctgcttcctcccacagcaaacacggcatgaatggctttttccagcaacaaatg
atgtacgactgcccaccgtctcggctgacatctgtctcgggagagtccagcctctacaac
ctgcccaggagctattcccatgacgtgttgccaaaggaatccccatcaagcacggaggca
gacggggagctttacacctttaacaccccatctgggactgcaggtgtagaaatgcagatg
agacatgtatccatcagttacgacattccgccaacacctggcaacacttaccagattcca
cggacatttccagaaagcacattgggacagtcatcaaagctggacaccattcctgatatc
cctccacctcggccaccaaagccacatccaactcatgaccggtctcctgtggaaacgtgt
ggagtcccacgcacggcctcggacactgacagcagttactgtatccctcctccagcaggc
atgccgccctcccggagtaataccatttccaccgtggatttgaacaagttgcggaaagat
gctagttctcaagattgctatgatattccacggacctttccgagcgatagatctagttcc
ctggaaggcttccatagccagtataaaatcaaaagcgtgttgacagcgggaggtgtctca
ggtgaagagctggatgagaactacgttcccatgaaccccaactcgccaccgagacaacat
tccggcagctttaccgagccaatccaggagccaaactatgtgccaatgaccccagggacc
tttgacttttcttcctttggaatgcaagtccctcctccggctcatatgggcttcaggtcc
agcccaaagacccctcccaggaggccagttcctgttgctgactgtgaaccacccccggtg
gataggaacctcaagccagacagaaaagtcaagccggcacctttagaaataaaacctcta
tcagaatgggaagagctgcaagccccagtcagatctcccatcactaggagcttcgctcgg
gactcctctaggtttcccatgtcccctcggcctgattctgtgcacagtacgacatcgagc
agcgactctcatgacagtgaagagaactatgtccccatgaatccaaatctgtctggcgaa
gacccgaatctctttgccagcaacagccttgatggggggagcagcccgatgaataaaccc
aaaggagacaaacaagtcgaatacttggatttagacctagattctgggaagtctacgcca
ccacggaagcaaaagaacagtggttctggcagcagcatggcagacgagagggtggattac
gtcgtggtggaccaacagaagactctggccctgaagagtaccagagaagcttggacggac
gggaggcagtccactgagtccgagacacccaccaagaatgtgaagtga

DBGET integrated database retrieval system