KEGG   Mus caroli (Ryukyu mouse): 110300158
Entry
110300158         CDS       T05910                                 

Gene name
Ikbkb
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01523  Antifolate resistance
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04062  Chemokine signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04068  FoxO signaling pathway
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04380  Osteoclast differentiation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal05010  Alzheimer disease
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05212  Pancreatic cancer
mcal05215  Prostate cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110300158 (Ikbkb)
   04014 Ras signaling pathway
    110300158 (Ikbkb)
   04064 NF-kappa B signaling pathway
    110300158 (Ikbkb)
   04668 TNF signaling pathway
    110300158 (Ikbkb)
   04068 FoxO signaling pathway
    110300158 (Ikbkb)
   04151 PI3K-Akt signaling pathway
    110300158 (Ikbkb)
   04150 mTOR signaling pathway
    110300158 (Ikbkb)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110300158 (Ikbkb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110300158 (Ikbkb)
   04621 NOD-like receptor signaling pathway
    110300158 (Ikbkb)
   04622 RIG-I-like receptor signaling pathway
    110300158 (Ikbkb)
   04623 Cytosolic DNA-sensing pathway
    110300158 (Ikbkb)
   04625 C-type lectin receptor signaling pathway
    110300158 (Ikbkb)
   04660 T cell receptor signaling pathway
    110300158 (Ikbkb)
   04658 Th1 and Th2 cell differentiation
    110300158 (Ikbkb)
   04659 Th17 cell differentiation
    110300158 (Ikbkb)
   04657 IL-17 signaling pathway
    110300158 (Ikbkb)
   04662 B cell receptor signaling pathway
    110300158 (Ikbkb)
   04062 Chemokine signaling pathway
    110300158 (Ikbkb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110300158 (Ikbkb)
   04920 Adipocytokine signaling pathway
    110300158 (Ikbkb)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110300158 (Ikbkb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110300158 (Ikbkb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300158 (Ikbkb)
   05206 MicroRNAs in cancer
    110300158 (Ikbkb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110300158 (Ikbkb)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110300158 (Ikbkb)
   05221 Acute myeloid leukemia
    110300158 (Ikbkb)
   05220 Chronic myeloid leukemia
    110300158 (Ikbkb)
   05215 Prostate cancer
    110300158 (Ikbkb)
   05222 Small cell lung cancer
    110300158 (Ikbkb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110300158 (Ikbkb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110300158 (Ikbkb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110300158 (Ikbkb)
   04932 Non-alcoholic fatty liver disease
    110300158 (Ikbkb)
   04931 Insulin resistance
    110300158 (Ikbkb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110300158 (Ikbkb)
   05135 Yersinia infection
    110300158 (Ikbkb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110300158 (Ikbkb)
   05170 Human immunodeficiency virus 1 infection
    110300158 (Ikbkb)
   05161 Hepatitis B
    110300158 (Ikbkb)
   05160 Hepatitis C
    110300158 (Ikbkb)
   05171 Coronavirus disease - COVID-19
    110300158 (Ikbkb)
   05164 Influenza A
    110300158 (Ikbkb)
   05162 Measles
    110300158 (Ikbkb)
   05168 Herpes simplex virus 1 infection
    110300158 (Ikbkb)
   05163 Human cytomegalovirus infection
    110300158 (Ikbkb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110300158 (Ikbkb)
   05169 Epstein-Barr virus infection
    110300158 (Ikbkb)
   05165 Human papillomavirus infection
    110300158 (Ikbkb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110300158 (Ikbkb)
   05142 Chagas disease
    110300158 (Ikbkb)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110300158 (Ikbkb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110300158 (Ikbkb)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     110300158 (Ikbkb)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   110300158 (Ikbkb)
SSDB
Motif
Pfam: IKBKB_SDD IKKbetaNEMObind ubiquitin
Other DBs
NCBI-GeneID: 110300158
NCBI-ProteinID: XP_021025887
LinkDB
Position
8
AA seq 524 aa
MPSSHLSSTVCPKICIPSVPQRPVCYKLGPQPLALLQKATGEQIAIKQCRQELSPKNRDR
WCLEIQIMRRHSKVRQKSEVDIVVSEDLNGAVKFSSSLPFPNNLNSVLAERLEKWLQLML
MWHPRQRGTDPQYGPNGCFRALDDILNLKLVHVLNMVTGTVHTYPVTEDESLQSLKTRIQ
EDTGILETXQELLQEAGLVLLPDKPATQCISDSXTNEGLTLDMDLVFLFDNSKINYETQI
TPRPQPESVSCIPSDKLLLAWREMEQAVEQCGRVGDSPQGSVLLAVAGTWRYHLPLPYPI
LHMTSSLKSSDVLARVSRLVCLDSGLLSSREEQARELYRRLREKPRDQRTEGDSQEMVRL
LLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDERTVVRLQEKRQKE
LWNLLKIACSKVRGPVSGSPDSMNVSRLSHPGQLMSQPSSACDSLPESDKKSEELVAEAH
ALCSRLESALQDTVKEQDRSFTTLDWSWLQMEDEERSSLEQACD
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgccgagctctcatctgagctccaccgtgtgccccaagatttgtatccccagtgtcccc
caaaggccagtgtgctacaagcttggtccccagcctcttgcactactgcagaaggcgaca
ggtgaacagatcgccatcaagcaatgccgacaggagctcagcccaaagaacagagaccgc
tggtgccttgagatccagatcatgagaaggcactccaaagtccggcagaagagcgaagta
gacatcgttgttagtgaagatttgaatggagcagtgaagttttcaagttcgctacccttc
cccaataatcttaacagtgtcctggctgaacggctggagaagtggctgcagctgatgctt
atgtggcaccctcggcaaaggggcacagatccccagtatggccccaacggctgcttcaga
gccctggatgacatcttgaacttgaagctggttcacgtcttgaacatggtcacaggcacc
gttcacacataccccgtgacggaggatgagagtctgcagagcttaaaaaccagaatccag
gaagacacagggatcctggagacagancaggagctgctgcaagaggcagggctggtgctg
ctccctgacaagcctgctactcagtgcatctcagacagcaanacaaacgagggcctcacg
ttggacatggatcttgtttttctctttgacaacagtaaaatcaactatgagactcagatc
accccccgaccccaaccggaaagtgtcagctgtatcccctcagataaattgctgctggcc
tggcgggagatggagcaggctgtggagcagtgtgggcgggtaggagactcaccccagggc
tctgtgcttctggctgtggccggaacttggcgctaccatcttccactcccttatccaata
ctgcatatgaccagtagtctaaaaagtagtgatgtgctggcaagagttagcaggctggtg
tgccttgactctggccttctctcttccagggaggaacaagcgagggagctctaccgaaga
ctcagggagaagccaagagaccaaaggacagaaggtgacagccaggagatggtacggctg
ctgcttcaggcaatccaaagctttgagaagaaagtgcgggtgatttatacacagctcagt
aagaccgtggtttgtaagcagaaggcactggagctgctgcccaaggtagaagaggtggtg
agccttatgaacgaggacgagaggaccgtggtccggcttcaggagaagcggcagaaggag
ctctggaacctcctgaagatcgcctgtagcaaagtccgaggtcccgtgagtggaagccca
gacagcatgaatgtgtctcgactcagtcaccctggtcagctaatgtcccagccttccagt
gcctgtgacagcttacctgaatcagacaagaaaagtgaagaactggtggccgaagcccac
gccctctgctcccggctagaaagtgcnctgcaggacacggtgaaggagcaagacagaagc
ttcacgactctagactggagctggttacagatggaggatgaagaaaggtctagcctggag
caggcctgtgactga

DBGET integrated database retrieval system