KEGG   Mus caroli (Ryukyu mouse): 110300159
Entry
110300159         CDS       T05910                                 

Gene name
Plat
Definition
(RefSeq) tissue-type plasminogen activator
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04371  Apelin signaling pathway
mcal04610  Complement and coagulation cascades
mcal05202  Transcriptional misregulation in cancer
mcal05215  Prostate cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110300159 (Plat)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110300159 (Plat)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110300159 (Plat)
  09162 Cancer: specific types
   05215 Prostate cancer
    110300159 (Plat)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110300159 (Plat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110300159 (Plat)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110300159 (Plat)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     110300159 (Plat)
Peptidases and inhibitors [BR:mcal01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110300159 (Plat)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   110300159 (Plat)
SSDB
Motif
Pfam: Trypsin Kringle DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 110300159
NCBI-ProteinID: XP_021025888
LinkDB
Position
8
AA seq 351 aa
MGSKMKRELLCVLLLCGLAFPLPDQGMHGRFRRGARSYRDWNSSVLSLKPYNARRPNAIK
LGLGNHNYCRNPDRDLKPWCYVFKAGKYTTEFCSTPACPKGFYAMTKNLKLFYRNPDGDA
RPWCHVMKDRKLTWEYCDMSPCSTCGLRQYKRPQFRIKGGLYTDITSHPWQAAIFAKNKR
SPGERFLCGGVLISSCWVLSAAHCFLERFPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIV
HEEFDDDTYDNDIALLQLRSQSKQCAQESSSVGTACLPDPNLQLPDWTECELSGYGKHEG
DSGGPLVCMINKQMTLTGIISWGLGCGQKDVPGVYTKVTNYLDWIHNNMKQ
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggggagcaaaatgaagagagagctgctgtgtgtactgctgctttgtggactggctttc
ccattgcctgaccagggaatgcacgggaggttcagaagaggagcccggtcctacagagac
tggaatagcagtgttctgtcgctgaaaccctacaatgcaaggaggccaaatgccatcaag
ctgggtcttgggaatcacaattactgcagaaacccagaccgagacttgaagccctggtgc
tatgtctttaaggcagggaagtataccacggagttctgtagcacgccagcttgccctaag
ggattctatgccatgactaaaaacctcaaactcttctacaggaatccagatggtgatgcc
agaccttggtgccatgtgatgaaggaccgaaagctgacgtgggaatactgtgacatgtcc
ccatgctccacctgtggcctgaggcagtacaaacggcctcagtttagaattaaaggagga
ctctacacagacatcacctcacacccttggcaggctgccatctttgccaagaacaagcgg
tctcccggagagaggttcctttgtggaggggtgctgatcagttcctgctgggtgctgtca
gctgcccactgctttctagagaggttcccccccaatcatcttaaagtggtcttgggcaga
acatacagggtggtccccggagaggaagagcagacatttgagattgaaaaatacatagtc
catgaggaatttgatgatgatacttatgacaacgacatcgcattactgcagctgaggtca
cagtccaagcaatgtgcccaggagagcagctctgttggcactgcctgcctccctgacccc
aacctgcagctccctgactggacagagtgtgagctttctggctatggcaagcatgagggt
gactcgggaggccctctggtgtgcatgatcaataaacagatgacactgacgggcattatc
agctggggcctcggctgtgggcagaaggatgtgcctggggtctacacaaaggttaccaat
tacctagactggattcacaacaacatgaagcaatga

DBGET integrated database retrieval system