KEGG   Mus caroli (Ryukyu mouse): 110300233
Entry
110300233         CDS       T05910                                 

Gene name
Hmox1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00860  Porphyrin and chlorophyll metabolism
mcal01100  Metabolic pathways
mcal04066  HIF-1 signaling pathway
mcal04216  Ferroptosis
mcal04978  Mineral absorption
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05225  Hepatocellular carcinoma
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    110300233 (Hmox1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110300233 (Hmox1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    110300233 (Hmox1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    110300233 (Hmox1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300233 (Hmox1)
   05206 MicroRNAs in cancer
    110300233 (Hmox1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110300233 (Hmox1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110300233 (Hmox1)
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     110300233 (Hmox1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 110300233
NCBI-ProteinID: XP_021025974
Ensembl: MGP_CAROLIEiJ_G0031232
UniProt: A0A6P5Q284
LinkDB
Position
8
AA seq 289 aa
MEHPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQETIPCTPATQHYVKRLHE
VGCTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRP
ASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagcatccacagcccgacagcatgccccaggatttgtctgaggccttgaaggaggcc
accaaggaggtacacatccaagccgagaatgctgagttcatgaagaactttcagaagggt
caggtgtccagagaaggctttaagctggtgatggcttccttgtaccatatctacacggcc
ctggaagaggagatagagcgcaacaagcagaacccagtctatgccccactctacttccct
gaggagctgcaccgaagggctgccctggagcaggatatggccttctggtatgggcctcac
tggcaggaaaccatcccttgcacgccagccacacagcactatgtaaagcgtctccacgag
gtgggatgcactcaccctgagctgctggtggcccacgcatatacccgctacctgggtgac
ctctcagggggtcaggtcctgaagaagattgcacagaaggctatggccttgcccagctct
ggagagggcctggctttttttaccttcccaaacatcgacagccccaccaagttcaaacag
ctctatcgtgctcgaatgaacactctggagatgacacctgaggtcaagcacagggtgaca
gaagaggctaagaccgccttcctgctcaacattgagttgtttgaggagctgcaggtgatg
ctgacagaggaacacaaagaccagagtccctcacagatggcatctcttcgtcagaggcct
gctagcctggtgcaagatactgcccctgcagagacaccccgagggaaaccccagatcagc
actagctcatcccagacgccgctcctccagtgggtcctcactctcagcttcctgttggca
acagtggcagtgggaatttatgccatgtaa

DBGET integrated database retrieval system