KEGG   Mus caroli (Ryukyu mouse): 110300284
Entry
110300284         CDS       T05910                                 

Gene name
Eif4ebp1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal03013  RNA transport
mcal04012  ErbB signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04218  Cellular senescence
mcal04910  Insulin signaling pathway
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05221  Acute myeloid leukemia
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110300284 (Eif4ebp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110300284 (Eif4ebp1)
   04066 HIF-1 signaling pathway
    110300284 (Eif4ebp1)
   04151 PI3K-Akt signaling pathway
    110300284 (Eif4ebp1)
   04152 AMPK signaling pathway
    110300284 (Eif4ebp1)
   04150 mTOR signaling pathway
    110300284 (Eif4ebp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110300284 (Eif4ebp1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110300284 (Eif4ebp1)
  09149 Aging
   04211 Longevity regulating pathway
    110300284 (Eif4ebp1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    110300284 (Eif4ebp1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110300284 (Eif4ebp1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110300284 (Eif4ebp1)
   05163 Human cytomegalovirus infection
    110300284 (Eif4ebp1)
   05165 Human papillomavirus infection
    110300284 (Eif4ebp1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110300284 (Eif4ebp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110300284 (Eif4ebp1)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     110300284 (Eif4ebp1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 110300284
NCBI-ProteinID: XP_021026061
Ensembl: MGP_CAROLIEiJ_G0030948
UniProt: A0A6P5Q808
LinkDB
Position
8
AA seq 117 aa
MSAGSSCSQTPSRAIPTRRVALGDGXQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLME
CRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSHLPSSPEDNRAGGEESQFEMDI
NT seq 354 nt   +upstreamnt  +downstreamnt
atgtcggcgggcagcagctgcagccagactcccagccgggccatccccactcgccgcgta
gccctcggcgacggcntgcagctcccgcctggggactacagcaccaccccgggcggcacg
ctcttcagcaccaccccgggaggaaccaggatcatctatgaccggaaattcttgatggag
tgtcggaactcacctgtagccaaaacacccccaaaggacctgccagccattcctggggtc
actagccctaccagtgatgagcctcccatgcaagccagccagagccacctgcccagcagc
ccggaagataatcgggcaggcggtgaagagtcacagtttgagatggacatttaa

KEGG   Mus caroli (Ryukyu mouse): 110305658
Entry
110305658         CDS       T05910                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal03013  RNA transport
mcal04012  ErbB signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04218  Cellular senescence
mcal04910  Insulin signaling pathway
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05221  Acute myeloid leukemia
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110305658
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110305658
   04066 HIF-1 signaling pathway
    110305658
   04151 PI3K-Akt signaling pathway
    110305658
   04152 AMPK signaling pathway
    110305658
   04150 mTOR signaling pathway
    110305658
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110305658
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110305658
  09149 Aging
   04211 Longevity regulating pathway
    110305658
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    110305658
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110305658
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110305658
   05163 Human cytomegalovirus infection
    110305658
   05165 Human papillomavirus infection
    110305658
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110305658
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110305658
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     110305658
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 110305658
NCBI-ProteinID: XP_021033375
UniProt: A0A6P5QIW2
LinkDB
Position
11
AA seq 117 aa
MSAGSSCSQTPSRAIPTRRVALGDGMQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLME
CRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSHLPSSPEDKRAGGEESQFEMDI
NT seq 354 nt   +upstreamnt  +downstreamnt
atgtcggcgggcagcagctgcagccagactcccagccgggccatccccactcgccgcgta
gccctcggcgacggcatgcagctcccgcctggggactacagcaccaccccgggcggcacg
ctcttcagcaccaccccgggaggaaccaggatcatctatgaccggaaattcttgatggag
tgtcggaactcacctgtagccaaaacacccccaaaggacctgccagccattcctggggtc
actagccctaccagtgatgagcctcccatgcaagccagccagagccacctgcccagcagc
ccggaagataagcgggcaggcggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system