KEGG   Mus caroli (Ryukyu mouse): 110300286
Entry
110300286         CDS       T05910                                 

Gene name
Cdh1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04371  Apelin signaling pathway
mcal04390  Hippo signaling pathway
mcal04514  Cell adhesion molecules
mcal04520  Adherens junction
mcal05100  Bacterial invasion of epithelial cells
mcal05200  Pathways in cancer
mcal05213  Endometrial cancer
mcal05216  Thyroid cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110300286 (Cdh1)
   04390 Hippo signaling pathway
    110300286 (Cdh1)
   04371 Apelin signaling pathway
    110300286 (Cdh1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110300286 (Cdh1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110300286 (Cdh1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300286 (Cdh1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110300286 (Cdh1)
   05216 Thyroid cancer
    110300286 (Cdh1)
   05218 Melanoma
    110300286 (Cdh1)
   05219 Bladder cancer
    110300286 (Cdh1)
   05213 Endometrial cancer
    110300286 (Cdh1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110300286 (Cdh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110300286 (Cdh1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mcal04515]
    110300286 (Cdh1)
   04090 CD molecules [BR:mcal04090]
    110300286 (Cdh1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110300286 (Cdh1)
Cell adhesion molecules [BR:mcal04515]
 Cadherins
  Major cadherins
   110300286 (Cdh1)
CD molecules [BR:mcal04090]
 Proteins
  110300286 (Cdh1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 Cadherin_3 Actino_peptide
Other DBs
NCBI-GeneID: 110300286
NCBI-ProteinID: XP_021026066
Ensembl: MGP_CAROLIEiJ_G0031521
UniProt: A0A6P5Q2F0
LinkDB
Position
8
AA seq 884 aa
MGARCRSFSALLLLLQVSSWLCQEPEPESCSPGFSSEVYTFLVPERHLERGHVLGRVRFE
GCTGRPRTAFFSEDSRFKVATDGTITVKRHLKLHKLETSFLVHAWDSSHRKLSTKVTLKS
MGHHHHRHHHRDPVSESNPELLMFPSVYPGLRRQKRDWVIPPISCPENEKGEFPKNLVQI
KSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSN
GEAVEDPMEIVITVTDQNDNRPEFIQAVFEGSVAEGALPGTSVMQVSATDADDDVNTYNA
AIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRESYHTYTLVVQAADLQGEGLSTT
AKAVITVTDINDNAPVFNPSTYQGQVPENEVNARIATLKVTDDDAPHTPAWNAVYTVVND
PDQQFVVVTDPTTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVI
DVNEAPIFMPVERRVEVPEDFGVGQEITSYTAREPDTFMGQKITYRIWRDTANWLEINPE
TGAIFTRAEMDREDTEHVKNSTYVALIIATDDGSPIATGTGTLLLVLLDVNDNAPIPEPR
NMEFCQRNPQPHIITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAAQESLILQPRKDL
EIGEYKINLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGAVEAGLEVPAILGILGGIL
ALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDA
RPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGS
GSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2655 nt   +upstreamnt  +downstreamnt
atgggagcccggtgccgcagcttttccgcgctcctgctcctgctgcaggtctcctcatgg
ctttgccaggagccggagcctgagtcctgcagtcccggcttcagttctgaggtctacacc
ttcctggtgccggagaggcacctggagagaggccacgtcctgggcagagtgagatttgaa
ggatgcactggccggccaaggacagccttcttttcagaagactcccgattcaaagtggcg
acagacggtaccatcacagtcaagcggcatctaaagctccataaactggagaccagtttc
cttgtccacgcctgggactccagtcataggaagctgtctaccaaagtgacgctgaagtcc
atggggcaccaccatcaccggcaccaccaccgcgaccccgtctctgaatccaacccagag
ctgctcatgtttcccagcgtgtacccaggtctcagaagacagaaacgagactgggtcatc
cctcccatcagctgccccgaaaatgaaaagggcgaattcccaaagaacctggttcagatc
aaatccaacagggacaaagaaacaaaggttttctacagcatcaccggccaaggagctgac
aaaccccctgttggtgttttcatcattgagagggagacaggctggctgaaagtgacacag
cctctggatagagaagccattgccaagtacatcctctattctcatgccgtgtcatcaaat
ggggaagcagtggaggatcccatggagatagtgatcacagtgacagatcagaatgacaac
aggccagagttcatccaggcggtctttgagggatccgttgcagaaggcgctcttccagga
acctctgtgatgcaggtctcagccaccgatgcagacgatgatgtcaacacctacaacgct
gccatcgcctacaccattgtcagccaggatcctgagctgcctcacaaaaacatgttcact
gtcaatagggacaccggggtcatcagtgtgctcacctccgggctggaccgagagagttac
catacatacactctggtggttcaggctgctgaccttcaaggcgaaggcttgagcacaaca
gccaaggctgtgatcactgtcacggatattaatgacaacgctcctgtcttcaacccgagc
acgtaccagggtcaagtgcctgagaatgaggtcaatgcccggattgccacactcaaggtg
actgatgatgatgccccccacaccccggcatggaatgctgtgtacaccgtagtcaatgat
cctgaccagcagttcgttgtcgtcacagaccccacgaccaatgatggcattttgaaaaca
gccaagggcttggattttgaggccaagcagcaatacattcttcatgtgagagtggagaac
gaggaaccctttgaggggtctcttgtcccttccacagccactgtcaccgtggacgtgata
gatgtgaatgaagcccccatctttatgcctgtggagaggagagttgaagtgccggaagac
tttggtgtgggtcaggaaatcacatcttataccgctcgagagccggacacgttcatgggt
cagaagatcacgtatcggatttggagagacactgccaactggctagagattaacccagag
actggtgccattttcacgcgcgctgagatggacagagaagacactgagcatgtgaagaac
agcacatacgtagctctcatcatcgccacggatgacggttcacccattgccaccggcacg
gggactcttctcctggtcctgttagatgtcaatgacaacgctcccatcccagaacctcga
aacatggagttctgccagaggaacccacagcctcatatcatcaccatcttggatccagac
cttccccccaacacgtcccccttcactgctgagctaacccatggggccagcgtcaactgg
accattgagtataatgacgcagctcaagaatctctcattttgcaaccaagaaaggactta
gagattggcgaatacaaaatcaatctcaagcttgcggataaccagaacaaagaccaagtg
accacgttggacgtccatgtgtgtgactgtgaagggacggtcaacaactgcatgaaggcg
ggagccgtggaagcaggattggaagttcctgccatccttggaatccttggagggatcctc
gccctgctgattctgatcctgctgctcctactgtttctgcggaggagaacggtggtcaaa
gagcccctgctgccaccagatgatgatacccgggacaatgtgtattactatgatgaagaa
ggaggtggagaagaagaccaggactttgatttgagccagctgcacaggggcctggatgcc
cgaccggaagtgactcgaaatgatgtggctcccaccctcatgagcgtgccccagtatcgt
ccccgtcctgccaatcctgatgaaattggaaacttcatcgatgaaaacctgaaggcagct
gacagcgaccccacggcacccccttatgactctctgttggtgttcgattacgagggcagt
ggttctgaagctgctagcctgagctcactgaactcctctgagtcggatcaggaccaggac
tacgattatctgaacgagtggggcaacagattcaagaagctggcggacatgtacggcggt
ggcgaggatgactag

DBGET integrated database retrieval system