KEGG   Mus caroli (Ryukyu mouse): 110300361
Entry
110300361         CDS       T05910                                 

Gene name
Tlr3
Definition
(RefSeq) toll-like receptor 3
  KO
K05401  toll-like receptor 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110300361 (Tlr3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110300361 (Tlr3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    110300361 (Tlr3)
   05160 Hepatitis C
    110300361 (Tlr3)
   05171 Coronavirus disease - COVID-19
    110300361 (Tlr3)
   05164 Influenza A
    110300361 (Tlr3)
   05168 Herpes simplex virus 1 infection
    110300361 (Tlr3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110300361 (Tlr3)
   05165 Human papillomavirus infection
    110300361 (Tlr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mcal04054]
    110300361 (Tlr3)
   04090 CD molecules [BR:mcal04090]
    110300361 (Tlr3)
Pattern recognition receptors [BR:mcal04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   110300361 (Tlr3)
CD molecules [BR:mcal04090]
 Proteins
  110300361 (Tlr3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR LRR_1 TIR_2 LRR_9 LRR_6 LRRNT LRRCT
Other DBs
NCBI-GeneID: 110300361
NCBI-ProteinID: XP_021026178
Ensembl: MGP_CAROLIEiJ_G0031020
LinkDB
Position
8
AA seq 905 aa
MKGCSSYLIYSFGGLLSLWILLVSSTNQCTVRYNVADCSHLKLTHIPDDLPSNITVLNLT
HNQLRRLPPTNFTRYSQLAILDAGFNSISKLEPELCQILPLLKVLNLQHNELSQISDQTF
VFCTNLTELYLMSNSIHKIKSNPFKNQKNLIKLDLSHNGLSSTKLGTGVQLENLQELLLA
KNKILALRSEELDFLGNSSLQKLDLSSNPLKEFSPGCFQTIGKLFTLLLNNAQLNPHLTE
KLCWELSNTSIQNLSLANNQLLATSESTFSGLKWTNLTWLDLSYNNLRDVGNGSFSYLPR
LRYLSLEYNNIQRLSPHSFYGLSNLRYLSLKRAFTKQSVSLASHPIIDDFSFQWLKYLEY
LNMDDNNIPSTKNNTFTGLVSLKYLSLSKTFTSLETLTNETFVSLAHSPLLTLNLSKNHI
SKIANGTFFWLGQLRILDLGLNEIEQKLSGQEWRGLRNIFEIYLSYNKYLQLSSSSFALV
PSLQRLMLRRVALKNVDISPSPFRPLRNLTILDLSNNNIANINEDLLEGLENLEILDFQH
NNLARLWKRANPGGPVNFLKGLSHLHVLNLESNGLDEIPVGVFKNLFELKSINLGLNNLN
KLEPFIFEDQTSLRSLNLQKNLITSVEKDVFGPPFQNLNSLDMRFNPFDCTCESISWFVN
WINQTHANISELSTHYLCNTPHHYYGFPLKLFDTSSCKDSAPFELLFITSTSMLLVFILM
VLLIHIEGWRISFYWNVSVHRILGFKEIDTQAEQFEYTAYIIHAHKDRDWVWEHFSPMEE
QDRSLKFCLEERDFEAGVLGLEAIVNSIKRSRKIIFIITHHLLKDPLCRRFKVHHAVQQA
IEQNLDSIILIFLQNIPDYKLNHALCLRRGMFKSHCILNWPVQKERINAFHHKLQVALGS
RNSAH
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgaaagggtgttcctcttatctaatatactcctttgggggacttttgtccctatggatt
cttctggtgtcttccacaaaccaatgcactgtgagatacaacgtagctgactgcagccat
ttgaagctaacacacatacctgatgaccttccctctaacataacagtgttgaatcttact
cacaaccaactcagaagattaccacctaccaattttacaagatacagccaacttgctatc
ttggatgcaggatttaactccatttcaaaactggagccagaactgtgccaaatactccct
ttgttgaaagtattgaacctgcaacataacgagctctctcagatttctgatcaaaccttt
gtcttctgcacgaacctgacagaactctatctaatgtctaactcaatacacaaaattaaa
agcaaccctttcaaaaaccagaagaatctaatcaaattagatttgtctcataatggttta
tcatcgacaaagttgggaacgggggtccaactggagaacctccaagaactgctcttagca
aaaaataaaatccttgcactgcgaagtgaagaacttgattttcttggcaattcttcttta
caaaaattggacttgtcatcaaatccacttaaagagttctccccggggtgtttccagaca
attggcaagttattcaccctcctcttgaacaacgcccaactgaacccccacctcacagag
aagctttgctgggaactttcaaacacaagcatccagaatctctctctggctaacaaccag
ctgctggccaccagtgagagcactttctctgggctgaagtggacaaacctcacctggctc
gatctttcctacaacaacctccgagatgtcggcaacggttccttctcctatctcccacgc
ctgaggtatctgtctctggagtacaacaatatacagcgtctgtcccctcactctttttat
ggactctccaacctgaggtacctgagtttgaagcgagcatttactaagcaaagtgtttca
cttgcttcacatcccatcattgacgatttttcctttcagtggttaaaatacttggaatat
ctcaacatggatgacaataatattcctagtaccaaaaacaataccttcacgggattggtg
agtctgaagtacctaagtctttccaaaactttcacaagtttggaaactttaacaaatgaa
acatttgtgtcgcttgctcattctcccttgctcactctcaatttatcgaaaaatcacatc
tcaaaaatagcaaatggtactttcttttggttgggccaactcaggatacttgatctcggc
cttaatgaaattgaacaaaaactcagcggccaggaatggagaggtctgagaaatatattt
gagatctacctatcctataacaaatatctccaactgtctagcagttcctttgctttggtc
cccagccttcaaagactgatgctcaggagggtggcccttaaaaatgtggatatctcccct
tcacctttccgccctcttcgtaacttgaccattctggacttaagcaacaacaacatagcc
aacataaatgaggacttgctggagggtcttgagaatctagaaattctggattttcagcac
aataacttagccaggctctggaagcgcgcaaaccccggtggtcccgttaatttcctaaag
ggtctgtctcacctccacgtcttgaatttagagtccaacggcttagatgaaatcccagtc
ggggttttcaagaacttattcgaactaaagagcatcaatctaggactgaataacttaaac
aaactggaaccattcatttttgaggaccagacatctctgaggtcactgaacctccagaag
aacctcatcacatccgttgagaaggatgttttcgggccgccttttcaaaacctgaacagt
ttagatatgcgcttcaatccgttcgactgcacgtgtgaaagtatttcctggtttgttaac
tggatcaaccagacccacgctaatatctctgagctgtccactcactacctctgtaacact
ccacatcattattatggcttccccctgaagcttttcgatacatcatcctgtaaagacagc
gccccctttgaactccttttcataaccagtaccagtatgctcctggtttttatacttatg
gtactgctcattcacatcgagggttggaggatctctttttactggaatgtttcggtgcat
cggattcttggtttcaaggaaatagacacacaggctgagcagtttgaatatacagcctac
ataatccatgcccataaagacagagactgggtctgggaacatttctccccaatggaagaa
caagaccgatctctcaaattttgcctagaagaaagggactttgaagcaggcgtccttgga
cttgaagcaattgttaatagcatcaaaagaagccgaaaaatcattttcattatcacacac
catctattaaaagaccctctgtgcagaagattcaaggtacatcacgcagttcagcaagct
attgagcaaaatctggattcaattatactgatttttctccagaatattccagattataaa
ctaaaccatgcactctgtttgcgaagaggaatgtttaaatctcattgcatcttgaactgg
ccagttcagaaagaacggataaatgcctttcatcataaattgcaagtagcacttgggtct
cggaattcagcacattaa

DBGET integrated database retrieval system