KEGG   Mus caroli (Ryukyu mouse): 110300435
Entry
110300435         CDS       T05910                                 

Gene name
Pard3
Definition
(RefSeq) partitioning defective 3 homolog isoform X1
  KO
K04237  partitioning defective protein 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04062  Chemokine signaling pathway
mcal04080  Neuroactive ligand-receptor interaction
mcal04144  Endocytosis
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04530  Tight junction
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110300435 (Pard3)
   04390 Hippo signaling pathway
    110300435 (Pard3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110300435 (Pard3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110300435 (Pard3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110300435 (Pard3)
   04530 Tight junction
    110300435 (Pard3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110300435 (Pard3)
  09158 Development and regeneration
   04360 Axon guidance
    110300435 (Pard3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110300435 (Pard3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110300435 (Pard3)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110300435 (Pard3)
SSDB
Motif
Pfam: Par3_HAL_N_term PDZ PDZ_2 PDZ_6 TSGP1
Other DBs
NCBI-GeneID: 110300435
NCBI-ProteinID: XP_021026268
Ensembl: MGP_CAROLIEiJ_G0031733
UniProt: A0A6P5Q8E4
LinkDB
Position
8
AA seq 1034 aa
MKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALTGLSTSVSDNNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDPSSWSNQFQRDNARSSLSASHPMVDRWLEKQEQDE
EGTEEDSSRVEPVGHADTGLENMPNFSLDDMVKLVQVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEQENLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMRARVIWFHVVPA
ANKEQYEQLSQHEKNNYSPGRFSPDSHCVANRSVANNAPQALPRAPRLSQPPEQLDAHPR
LPHSAHASTKPPAAPALAPPSVLSTSVGSVYNTKKVGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTV
SLLVFRQEEAFHPREMNAEPSQMQTPKETKAEDEDVVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAME
TLRRSMSTEGNKRGMIQLIVARRISRCNELRSPGSPAAPELPIETELDDRERRISHSLYS
GIEGLDESPTRNAALSRIMGESGKCQLSPTVNMPHDDTVMIEDDRLPVLPPHLSDQSSSS
SHDDVGFIMTEAGTWAKATISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQRAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGNIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPMVDDDDEGMETLEEDTEESSRSGR
ESVSTSSDQPSYSLERQMNGDPEKRDKTERKKDKAGKDKKKDREKEKDKLKAKKGMLKGL
GDMFSLAKLKPEKR
NT seq 3105 nt   +upstreamnt  +downstreamnt
atgaaagtgaccgtgtgcttcgggaggacccgggtggtcgtgccgtgcggagatggccgc
atgaaagttttcagcctcatccagcaggcggtgacccgctaccggaaggccgtggccaag
gatccaaactactggatacaggtgcatcgcttggagcatggagatggagggattctagac
ctggatgacatcctctgtgacgttgctgatgacaaagacagactggtagcagtgtttgat
gaacaggatccccaccatggaggagatggtaccagcgccagctccacgggaacccagagt
ccagagatattcggcagtgagctgggcaccaacaatgtttctgcttttcagccttatcaa
gccacaagtgaaattgaggtcacgccttcagttcttcgggcaaatatgcctcttcatgtc
cgccggagcagcgacccagctttaactggcctttccacttctgtcagtgataacaacttt
tcctcagaggagccctccaggaaaaaccccacccgctggtccacaacagctggctttctc
aagcagaacaccgctggaagtcccaaaacctgcgacaggaagaaagatgaaaactacaga
agccttccacgggatcccagtagctggtccaaccagttccagcgagacaacgcccgctca
tctctgagtgccagccacccaatggtagaccggtggctggagaagcaagaacaggatgag
gaaggcacagaagaagacagcagccgagtggagccagttggacatgctgatactggattg
gagaacatgcccaacttttccctcgatgatatggtaaagctcgtacaagtccccaacgat
ggagggcccctgggaatccatgtagtgcctttcagtgctcgaggcggcagaacactgggg
ttgttagtgaagcggttggagaaaggtggtaaggctgagcaagaaaaccttttccatgag
aatgactgcattgtgaggattaacgatggagaccttcgaaacagaagatttgagcaagca
caacatatgttccgccaagccatgcgtgcgcgtgtcatttggttccacgtggtccctgca
gcaaacaaggagcagtatgaacaactctcccaacacgagaagaacaactactccccaggc
cgcttcagccctgacagccactgtgtggccaataggagtgtggccaacaatgcccctcaa
gcattgcccagagcacccagactgagtcagccacccgagcagctggatgctcacccccga
ctacctcatagtgctcacgcctcaaccaaaccacccgcagccccggccttggctccaccc
agtgtgcttagtaccagtgtaggcagtgtgtacaacacgaagaaagtaggcaagaggctc
aacatccagcttaagaaaggtacagaaggactgggattcagcatcacctccagggacgtc
accataggtggctcagctcccatttatgtcaagaatatccttcctcgaggggctgccatt
caggatggcagactcaaggcaggagaccggctaatagaggtcaatggagtagatttagca
ggcaaatcccaggaggaagttgtttccctgttgagaagcaccaagatggaggggactgtg
agccttctggtctttcgtcaggaagaggctttccacccaagggaaatgaatgctgaacca
agccagatgcagactccaaaagaaacgaaagctgaagatgaggacgttgttctcacaccc
gatggtaccagggagtttctgacttttgaagttccactgaatgactcaggatctgcaggg
cttggtgtcagtgtcaaggggaaccgttccaaagagaaccacgcagatttggggatcttc
gttaagtccattatcaatggtggagctgcatctaaagatggaaggctgagggtaaatgac
cagctgatagctgtgaatggagaatctctgctgggcaaagccaaccaggaagccatggag
actctacggaggtccatgtccaccgagggcaacaagcgaggcatgatccagctcattgtg
gcgaggcggatcagcagatgtaacgagctgcggtctcctgggagccctgctgcacctgag
ctgcccatcgaaacagaactggatgaccgagaacgtaggatctcacactccctctacagt
gggatcgaggggctggatgagtcgcccaccaggaacgcagcactgagcaggataatgggt
gagtcaggtaaatgccagctgtcccccacggtgaacatgcctcacgatgacactgtcatg
attgaagatgacaggctgcctgtgctccctcctcacctctctgaccagtcctcttccagc
tcccatgatgacgttgggttcataatgacagaagcaggcacgtgggccaaagctaccatc
agtgactcagccgactgctcattgagtccagatgttgatccggttctcgcttttcaacgg
gaaggatttggacgccagagtatgtcagaaaaacgcacaaagcaattttcagatgccagt
caattggatttcgttaaaacacgaaaatcaaaaagcatggatttaggtatagctgacgag
actaaactcaatacagtggatgaccagagagcaggctctcccagtagagatgtgggaccc
tccttaggtctgaagaaatctagctccttagaaagtctgcagaccgctgtcgctgaggtg
acgctgaacgggaacattcctttccaccgccctcggccaagaatcatccggggaaggggc
tgcaacgaaagcttcagagccgccattgacaagtcctacgacaagcccatggttgatgac
gacgacgaaggcatggagaccttggaagaagacacagaggaaagctcaaggtcagggagg
gagtccgtgtccacgtccagcgatcagccttcctattctctggagagacaaatgaatgga
gacccagagaaaagggacaagacagagaggaaaaaggacaaagctggaaaggataagaag
aaagaccgagagaaggagaaggataaactgaaagccaaaaaggggatgctgaaaggcttg
ggggacatgttcagcctggccaaactgaagccggagaagagatga

DBGET integrated database retrieval system