KEGG   Mus caroli (Ryukyu mouse): 110300541
Entry
110300541         CDS       T05910                                 

Gene name
Tradd
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04210  Apoptosis
mcal04217  Necroptosis
mcal04622  RIG-I-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal05132  Salmonella infection
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110300541 (Tradd)
   04064 NF-kappa B signaling pathway
    110300541 (Tradd)
   04668 TNF signaling pathway
    110300541 (Tradd)
   04071 Sphingolipid signaling pathway
    110300541 (Tradd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110300541 (Tradd)
   04217 Necroptosis
    110300541 (Tradd)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    110300541 (Tradd)
   04657 IL-17 signaling pathway
    110300541 (Tradd)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110300541 (Tradd)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110300541 (Tradd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110300541 (Tradd)
   05152 Tuberculosis
    110300541 (Tradd)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110300541 (Tradd)
   05160 Hepatitis C
    110300541 (Tradd)
   05164 Influenza A
    110300541 (Tradd)
   05162 Measles
    110300541 (Tradd)
   05168 Herpes simplex virus 1 infection
    110300541 (Tradd)
   05163 Human cytomegalovirus infection
    110300541 (Tradd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110300541 (Tradd)
   05169 Epstein-Barr virus infection
    110300541 (Tradd)
   05165 Human papillomavirus infection
    110300541 (Tradd)
SSDB
Motif
Pfam: TRADD_N Death CARD_2
Other DBs
NCBI-GeneID: 110300541
NCBI-ProteinID: XP_021026411
Ensembl: MGP_CAROLIEiJ_G0031467
UniProt: A0A6P5Q8S7
LinkDB
Position
8
AA seq 310 aa
MAASHNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQ
ILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGATQVAPAGS
KSPVSSPTQEKPLPAACQTFLFHGQPVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLL
GQAGPDGGLA
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcagccagtcataatggccacgaggagtgggtgggcagtgcatacctgtttttggag
tctgcggtggacaaggtgatcctgtctgaagcctacacggatcccaagaagaaggtggca
atatacaaggctctgcagactgcactgtcagagagtggggacagctctgacgtactgcag
atactcaagatccactgcagcgaccctcagctcatcgtccagttgcggttctgcgggcga
gtgctgtgcggccgcttcctccaagcctaccgcgagggggcgctgcgcaccgcgctgcag
aggtgcatggccccggcgcttgcccaggaagcgctgcggttacagctggagttgcgtgct
ggtgcggagcagctggacagttggctgactgacgaagagcgctgtttgaattacatctta
gcccagaagcccgaccggctcagggacgaggaactcgcggagctggaggatgagctctgc
aaactgacgtgtgactgcactggccagggtggagccacacaggtagctcctgcaggttcg
aagtccccggtttcctctccgacccaggagaaaccactgccggccgcctgccagactttt
ctgttccatgggcagcccgtagtgaaccggccactgactcttcaagaccagcagacgttt
gcgcgctcggtgggcctcaagtggcgcagggtggggcgctcgctgcagcgtaactgtcgg
gcactgagagatcctgccctcgactcgctggcctatgagtatgagcgtgatgggctatac
gagcaggccttccagctgctgcgccgtttcatgcaagcggagggccgccgtgccacactg
caacgcctggtggaggcgctggaggagaacgaactcactagtctagcagaggatctgctg
ggccaggcgggaccggatggcggcctggcctaa

DBGET integrated database retrieval system