KEGG   Mus caroli (Ryukyu mouse): 110300622
Entry
110300622         CDS       T05910                                 

Gene name
Insr
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04520  Adherens junction
mcal04910  Insulin signaling pathway
mcal04913  Ovarian steroidogenesis
mcal04923  Regulation of lipolysis in adipocytes
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04960  Aldosterone-regulated sodium reabsorption
mcal05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110300622 (Insr)
   04014 Ras signaling pathway
    110300622 (Insr)
   04015 Rap1 signaling pathway
    110300622 (Insr)
   04066 HIF-1 signaling pathway
    110300622 (Insr)
   04068 FoxO signaling pathway
    110300622 (Insr)
   04072 Phospholipase D signaling pathway
    110300622 (Insr)
   04022 cGMP-PKG signaling pathway
    110300622 (Insr)
   04151 PI3K-Akt signaling pathway
    110300622 (Insr)
   04152 AMPK signaling pathway
    110300622 (Insr)
   04150 mTOR signaling pathway
    110300622 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110300622 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110300622 (Insr)
   04923 Regulation of lipolysis in adipocytes
    110300622 (Insr)
   04913 Ovarian steroidogenesis
    110300622 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110300622 (Insr)
  09149 Aging
   04211 Longevity regulating pathway
    110300622 (Insr)
   04213 Longevity regulating pathway - multiple species
    110300622 (Insr)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110300622 (Insr)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110300622 (Insr)
   04932 Non-alcoholic fatty liver disease
    110300622 (Insr)
   04931 Insulin resistance
    110300622 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110300622 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcal04090]
    110300622 (Insr)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110300622 (Insr)
Protein kinases [BR:mcal01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   110300622 (Insr)
CD molecules [BR:mcal04090]
 Proteins
  110300622 (Insr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 Kinase-like DUF4476
Other DBs
NCBI-GeneID: 110300622
NCBI-ProteinID: XP_021026530
Ensembl: MGP_CAROLIEiJ_G0030765
UniProt: A0A6P5Q941
LinkDB
Position
8
AA seq 1384 aa
MGFGRGCETTAVPLLVAVAALLVGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRKTSSGNGAEDSRPSRKRRSLEEVGNVTATTLTLP
EFPNTSSTIVPTSQEEHRPYEKVVNKESLVISGLRHFTGYRIELQACNQDSPDERCSVAA
YVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHL
CVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKII
IGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEV
PREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIEFLNEASVM
KGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQ
MTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLL
PVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPP
DNCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLDPSFPEVSFFYSEENKAPESEELE
MEFEDMENVPLDRSSHCLREEAGGREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPR
SNPS
NT seq 4155 nt   +upstreamnt  +downstreamnt
atgggcttcgggagaggatgtgagacgacggctgtgccattgctggtggccgtggccgcg
ttgctggtgggcacagccggccacctgtaccctggagaggtgtgccctggtatggacatc
cggaacaacctgaccaggctacatgagctggagaactgctcagtcattgagggccatctg
cagatcctcctgatgttcaagaccagacctgaagatttccgagacctcagtttccccaaa
ctcatcatgatcacagactacctgcttctcttccgtgtctatggcctggaaagtctgaaa
gacctcttcccaaacctcacagtcatccgaggctcccgtctctttttcaactatgccctg
gttatcttcgagatggtccacctgaaggagctggggctttacaacctcatgaacatcacc
cggggctctgtccgcatcgagaagaataatgagctctgctacctggccactatcgactgg
tcccgtatcctggattctgtggaggacaactacattgtactgaacaaagatgacaacgag
gaatgtggggatgtctgtccaggcactgccaagggaaagaccaactgccctgccaccgtc
atcaatgggcagtttgtagaacggtgctggacacacagtcattgtcagaaagtttgccca
accatctgtaagtcacatggctgcacagctgaaggcctatgctgccacaaggagtgcctg
ggcaactgttcggaacctgatgaccccaccaagtgtgtggcctgtcgcaacttctatctg
gatggtcagtgtgtggagacctgcccgccaccctactatcacttccaggactggcgctgt
gtgaactttagcttctgccaagaccttcacttcaaatgcaggaactctcggaagcctggc
tgccaccaatacgtcattcataacaacaagtgcatccccgagtgcccgtctggttatacc
atgaattccagcaacttgatgtgcaccccatgtctgggaccctgccctaaggtctgccaa
atcctcgaaggcgagaagaccattgattctgtgacatctgcccaggagctccgaggctgc
actgtgatcaacggtagcctgatcatcaacatccgagggggcaacaacctggcagctgag
ctggaggctaaccttggcctcattgaagaaatttcaggatttctaaagatccgccgctcc
tatgctctggtatcactttctttcttcaggaagctacatctgattcgaggagagaccttg
gaaattgggaactattctttctatgccttggacaaccagaacctgaggcaactctgggac
tggagcaaacacaacctcaccatcactcagggcaagctcttcttccattacaacccgaaa
ctctgcttgtctgaaattcacaagatggaagaggtctccggaactaagggccgccaggag
aggaacgacattgccctgaagaccaatggagaccaggcatcgtgtgaaaatgaattgctt
aaattttctttcattcggacatcttttgacaagatcctgctgagatgggaaccctactgg
ccccccgacttccgagatctcctgggattcatgttgttctacaaagaggccccttatcag
aacgtgacagagtttgatgggcaggatgcttgtggctccaacagctggactgtggtggat
attgacccgccccagaggtccaatgaccccaagtctcagaccccaagtcaccctgggtgg
ctgatgcggggcctcaaaccttggacccaatacgccatctttgtgaagaccttggttacc
ttctctgatgaacggcggacttatggagccaaaagtgatatcatctatgtgcaaacagat
gccaccaatccttctgtccccctggatcccatatcagtttctaattcctcatctcagatt
atcttaaagtggaagcccccctctgaccccaatggcaacatcacacactacctggtgtac
tgggagaggcaggcagaggacagcgagctgtttgagctggattattgtctcaaagggctg
aagctcccttcacggacctggtccccaccttttgagtctgatgattctcagaagcacaat
cagagtgagtatgacgactcggccagtgagtgctgctcatgccctaagactgactctcag
atcctgaaggagctggaggagtcttcattcaggaagaccttcgaggattacctgcacaac
gtggtttttgtccccagaaaaacctcttcaggcaatggtgccgaggacagtaggccatcc
cgaaagcgaagatcccttgaagaggtggggaatgtgacagccaccacgctcacacttcca
gagttccccaacacctcctccaccattgtgcccacaagccaggaggagcacaggccatat
gagaaagtggtgaacaaggagtcacttgtcatttctggcctgagacacttcactgggtac
cgcattgagctgcaggcatgcaatcaagattccccagatgagaggtgcagtgtggctgcc
tacgtcagtgcccggaccatgcctgaagctaaggcagatgacatcgttggccctgtgacc
catgaaatctttgagaacaatgttgtacacttaatgtggcaagagccaaaggaacctaat
ggtctgattgtgttatatgaagtgagctatcgccgatatggtgatgaggagctgcacctc
tgtgtctcccggaagcattttgccctggagcggggctgcaggctgcgagggctctcccca
ggaaactacagtgttcgagtccgggctacctctctggcaggaaatggctcctggacagaa
cccacttatttttatgtgactgattatttagatgtcccatcaaatattgccaaaattatt
attgggcccctcatctttgtcttcctcttcagtgttgtgattggaagtatttatctattt
ctgagaaagaggcagccggatgggccaatgggaccactgtatgcatcttcaaaccctgag
tacctcagtgccagtgatgtgtttccatcttctgtgtacgtgccggacgagtgggaggta
cctcgagagaagatcacccttcttcgagagctggggcagggatcctttggtatggtgtat
gaaggcaatgccaaggatatcatcaagggtgaggcagagacccgtgttgcggtgaagaca
gtcaatgaatcagccagtcttcgagaacggattgagttcctcaatgaggcatcagtcatg
aagggtttcacctgccatcatgtggtccgccttcttggggtggtatccaaaggacagcca
acactggtagtgatggaattgatggctcatggagacctgaaaagtcacctccgttctctg
aggccagatgctgagaataacccaggccgccctccccctaccttgcaagaaatgattcag
atgacagcagaaattgctgatggcatggcatacttgaacgccaagaagtttgtgcaccgg
gacctggcagctcgaaactgcatggttgcccatgattttactgtcaaaattggagacttt
ggaatgacaagggacatctacgagacagattactatcggaaagggggcaaggggctgctg
cctgtgaggtggatgtcacctgagtccctgaaggatggagtctttactgcttcttctgat
atgtggtcctttggggtggtcctttgggaaatcactagcctggctgagcaaccttatcaa
ggcctgtctaatgaacaggtgttgaagtttgtcatggatggaggctatctggatccccct
gataactgtccagagagactcactgacctgatgcgcatgtgctggcagttcaaccccaag
atgaggccaaccttcctggaaatcgtcaacctgctcaaggatgacctcgaccccagcttt
ccagaagtttccttcttctacagcgaggagaacaaggctcctgagagtgaggagctggag
atggagtttgaggacatggagaatgtccccttggatcgttcctctcactgtctgagagaa
gaggctgggggccgggagggagggtcctcactgagcatcaaacggacctatgatgaacac
atcccctatacccacatgaatgggggcaagaagaacgggcgtgtcctcaccctgccaagg
tcaaacccttcctaa

DBGET integrated database retrieval system