KEGG   Mus caroli (Ryukyu mouse): 110301002
Entry
110301002         CDS       T05910                                 

Gene name
Pkm
Definition
(RefSeq) pyruvate kinase PKM isoform X1
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00010  Glycolysis / Gluconeogenesis
mcal00230  Purine metabolism
mcal00620  Pyruvate metabolism
mcal01100  Metabolic pathways
mcal01200  Carbon metabolism
mcal01230  Biosynthesis of amino acids
mcal01240  Biosynthesis of cofactors
mcal04922  Glucagon signaling pathway
mcal04930  Type II diabetes mellitus
mcal05165  Human papillomavirus infection
mcal05203  Viral carcinogenesis
mcal05230  Central carbon metabolism in cancer
Module
mcal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcal_M00002  Glycolysis, core module involving three-carbon compounds
mcal_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mcal_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110301002 (Pkm)
   00620 Pyruvate metabolism
    110301002 (Pkm)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110301002 (Pkm)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110301002 (Pkm)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110301002 (Pkm)
   05230 Central carbon metabolism in cancer
    110301002 (Pkm)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110301002 (Pkm)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110301002 (Pkm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110301002 (Pkm)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110301002 (Pkm)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     110301002 (Pkm)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    110301002 (Pkm)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110301002 (Pkm)
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-GeneID: 110301002
NCBI-ProteinID: XP_021026870
Ensembl: MGP_CAROLIEiJ_G0032307
UniProt: A0A6P5QGC9
LinkDB
Position
9
AA seq 591 aa
MTQPFNFAAFEKFFFLGSSGQSILHSERSFQVRPPSHTESTKQQYAIRSPDPENQRTSGT
MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEM
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRLLFEELVRASSHSTDLMEAMAMGSVEAS
YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLN
AWAEDVDLRVNLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgactcaacctttcaactttgcggcttttgagaaatttttcttccttggctcttcaggg
caaagcatactccactctgagcgatctttccaagtgaggccaccaagccacactgagtca
acaaaacagcaatatgccatcagaagcccagacccagagaaccaaaggacttcaggaacc
atgccgaagccacacagtgaagcaggcactgccttcattcagacccagcagctccatgca
gccatggctgacaccttcctggaacacatgtgccgcctggacattgattctgcccccatc
acggcccgcaacactggcatcatttgtaccattgggcctgcttcccgatctgtggagatg
ctgaaggagatgattaagtctggaatgaatgtggctcggctgaatttctctcatggaacc
catgagtaccatgcagagaccatcaagaatgtccgtgaagccacagaaagctttgcatct
gatcccattctctaccgtcctgttgcggtggctctggatacaaagggacctgagatccgg
actggactcatcaagggcagcggtactgctgaggtggagctgaagaagggagccactctg
aagatcaccctggacaacgcttacatggagaagtgtgacgagaacatcctgtggctggac
tacaagaacatctgcaaggtggtggaggttggcagcaagatctacgtggacgatgggctc
atctcactgcaggtgaaggagaaaggtgctgacttcctggtgacagaggtggagaatggt
ggctccttgggcagcaagaagggcgtgaacctgcctggagctgctgtggatctccctgct
gtgtcagaaaaggacatccaggacctgaagtttggggtggagcaggatgtggacatggtg
tttgcatctttcatccgcaaggcagccgacgtgcatgaagtcaggaaggtgctgggagag
aagggcaagaacatcaagatcatcagcaaaatcgagaaccatgaaggtgtccgaaggttt
gatgagatcttggaggccagtgatgggatcatggtggctcgtggtgacctgggcattgag
attcctgcagagaaggtcttcctggctcagaagatgatgatcgggagatgcaaccgagct
gggaagcctgtcatctgtgccacacagatgctggagagcatgatcaagaagccacgcccc
acccgtgctgaaggcagtgatgtggccaatgcagtcctggatggagcagattgcatcatg
ctgtctggagaaacagccaagggggactaccctctggaggctgtccgcatgcagcacctg
atagctcgggaggctgaggcagccatgttccaccgtctgctgtttgaagagcttgtgcga
gcctccagtcactccacagacctcatggaggccatggccatgggcagcgtggaggcctct
tataagtgtttagcggcagctttgatagttctcacggagtctggcaggagtgctcaccaa
gtggccaggtaccgccctcgggctcctatcattgccgtgactcgcaatccccagactgct
cgccaggcccatctgtaccgtggcattttccctgtgctgtgtaaggatgccgtactgaat
gcctgggctgaggatgtggaccttcgtgtaaacttggccatggatgttggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccgggtggcgccctggctctgga
ttcaccaacaccatgcgtgtagtgcctgtaccttga

DBGET integrated database retrieval system