KEGG   Mus caroli (Ryukyu mouse): 110301052
Entry
110301052         CDS       T05910                                 

Gene name
Ctnnb1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04310  Wnt signaling pathway
mcal04390  Hippo signaling pathway
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04670  Leukocyte transendothelial migration
mcal04916  Melanogenesis
mcal04919  Thyroid hormone signaling pathway
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05100  Bacterial invasion of epithelial cells
mcal05132  Salmonella infection
mcal05160  Hepatitis C
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110301052 (Ctnnb1)
   04310 Wnt signaling pathway
    110301052 (Ctnnb1)
   04390 Hippo signaling pathway
    110301052 (Ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110301052 (Ctnnb1)
   04520 Adherens junction
    110301052 (Ctnnb1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110301052 (Ctnnb1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110301052 (Ctnnb1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110301052 (Ctnnb1)
   04916 Melanogenesis
    110301052 (Ctnnb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301052 (Ctnnb1)
   05205 Proteoglycans in cancer
    110301052 (Ctnnb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110301052 (Ctnnb1)
   05225 Hepatocellular carcinoma
    110301052 (Ctnnb1)
   05226 Gastric cancer
    110301052 (Ctnnb1)
   05216 Thyroid cancer
    110301052 (Ctnnb1)
   05217 Basal cell carcinoma
    110301052 (Ctnnb1)
   05215 Prostate cancer
    110301052 (Ctnnb1)
   05213 Endometrial cancer
    110301052 (Ctnnb1)
   05224 Breast cancer
    110301052 (Ctnnb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110301052 (Ctnnb1)
   05022 Pathways of neurodegeneration - multiple diseases
    110301052 (Ctnnb1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110301052 (Ctnnb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110301052 (Ctnnb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110301052 (Ctnnb1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110301052 (Ctnnb1)
   05100 Bacterial invasion of epithelial cells
    110301052 (Ctnnb1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110301052 (Ctnnb1)
   05163 Human cytomegalovirus infection
    110301052 (Ctnnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110301052 (Ctnnb1)
   05165 Human papillomavirus infection
    110301052 (Ctnnb1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 110301052
NCBI-ProteinID: XP_021026938
Ensembl: MGP_CAROLIEiJ_G0032821
UniProt: A0A6P5QGH1
LinkDB
Position
9
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgacctgatggagttggacatggccatggagccggacagaaaagct
gctgtcagccattggcagcagcagtcttacttggattctggaatccattctggtgccacc
accacagctccttccctgagtggcaagggcaaccctgaggaagaggatgttgacacctcc
caagtcctttatgaatgggagcaaggcttttcccagtccttcacgcaagagcaagtagct
gatattgacgggcagtatgcaatgactagggctcagagggtccgagctgccatgttccct
gagacgctagatgagggcatgcagatcccatccacacagtttgatgctgctcatcccact
aatgtccagcgcttggctgaaccatcacagatgttgaaacatgcagttgtcaatttgatt
aactatcaggatgacgcggaacttgccacacgtgcaattcctgagctgacaaaactgcta
aacgatgaggaccaggtggtagttaataaagctgctgttatggtccatcagctttccaaa
aaggaagcttccagacatgccatcatgcgctcccctcagatggtgtctgccattgtacgc
accatgcagaatacaaatgatgtagagacagctcgttgtactgccggaactctgcacaac
ctttctcaccaccgcgagggcttgctggccatctttaagtctggcggcatcccagcgctg
gtgaaaatgcttgggtcaccagtggattctgtactgttctacgccatcacgacactgcat
aatctcctgctccatcaggaaggagctaaaatggcagtgcgcctagctggtggactgcag
aaaatggttgctttgctcaacaaaacaaacgtgaaattcttggctattacaacagactgc
cttcagatcttagcttatggcaatcaagagagcaagctcatcattctggccagtggtggg
ccccaagccttagtaaacataatgaggacctacacttacgagaagcttctgtggaccaca
agcagagtgctgaaggtgctgtctgtctgctctagcaacaagccggccattgtagaagct
ggtgggatgcaggcactggggcttcatctgacagacccaagtcagcgacttgttcaaaac
tgtctttggactctcagaaacctttcagatgcagcgactaagcaggaagggatggaaggc
ctccttgggactctagtgcagcttctgggttccgatgatataaatgtggtcacctgtgca
gctggaattctctctaacctcacttgcaataattacaaaaacaagatgatggtgtgccaa
gtgggtggcatagaggctcttgtacgtaccgtccttcgtgctggtgacagggaggacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccggcatcaggaagccgagatg
gcccagaatgccgttcgccttcattatggactgcctgttgtggttaaactcctgcaccca
ccatcccactggcctctgataaaggcaactgttggattgattcgaaaccttgccctttgc
ccagcaaatcatgcgcctttgcgggaacagggggctattccacgactagttcagctgctt
gtacgagcacatcaggacacccaacggcgcacctccatgggtggaacgcagcagcagttt
gtggagggtgtgcgcatggaggagatagttgaagggtgtactggagctcttcacatcctc
gctcgggacgttcacaaccggattgtaatccgaggactcaataccattccattgtttgtg
cagttgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaggccattgaagctgagggagctacagctcccctg
acagagttactccactccaggaatgaaggcgtggcaacatacgcagctgctgtcctattc
cgaatgtctgaggacaagccacaggattacaagaagcggctttcagtcgagctgaccagt
tccctcttcaggacagagccaatggcttggaatgagactgcagatcttggactggacatt
ggtgcccagggagaagcccttggatatcgccaggatgatcccagctaccgttcttttcac
tctggtggatacggccaggatgccttggggatggaccctatgatggagcatgaaatgggt
ggccaccaccctggtgctgactatccagttgatgggctgcctgatctggggcatgcccag
gacctcatggatgggctgcccccaggtgatagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system