KEGG   Mus caroli (Ryukyu mouse): 110301441
Entry
110301441         CDS       T05910                                 

Gene name
Atm
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal03440  Homologous recombination
mcal04064  NF-kappa B signaling pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05202  Transcriptional misregulation in cancer
mcal05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    110301441 (Atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110301441 (Atm)
   04068 FoxO signaling pathway
    110301441 (Atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110301441 (Atm)
   04210 Apoptosis
    110301441 (Atm)
   04115 p53 signaling pathway
    110301441 (Atm)
   04218 Cellular senescence
    110301441 (Atm)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110301441 (Atm)
   05206 MicroRNAs in cancer
    110301441 (Atm)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110301441 (Atm)
   05170 Human immunodeficiency virus 1 infection
    110301441 (Atm)
   05165 Human papillomavirus infection
    110301441 (Atm)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110301441 (Atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110301441 (Atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcal03032]
    110301441 (Atm)
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110301441 (Atm)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110301441 (Atm)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   110301441 (Atm)
DNA replication proteins [BR:mcal03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     110301441 (Atm)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110301441 (Atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC RYDR_ITPR
Other DBs
NCBI-GeneID: 110301441
NCBI-ProteinID: XP_021027569
Ensembl: MGP_CAROLIEiJ_G0032216
UniProt: A0A6P5QBV7
LinkDB
Position
9
AA seq 3064 aa
MSLALNDLLICCRQLEHDRATERRKEVDKFKRLIQDPETVQHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETESLRTAKSNVSATTQSSRQKKMQEISSLVRYFIKCANRRAPRLKCQDL
LNYVMDTVKDSSNGVTYGADCSNILLKDILSVRKYWCEVSQQQWLELFSLYFRLYLKPSQ
DINRVLVARIIHAVTRGCCSQTDGLPSKFLDLFSKAIQYARQEKSSPGLSHILAALNIFL
KTLAVNFRKQVCEVGDEILPTLLYIWTQHRLNDSLKEVIIELIQLQIYIHHPQGARAPEE
GAYESMKWKSILYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIDLMADICYQLFDAD
TRSVEISQSYVTQRESTDYSVPCKRRKIDVGWEVIKDNLQKSQNDFDLVPWLQITTRLIS
KYPSSLPNCELSPLILILYQLLTQQRRGERIPYVLRCLKEVALCQGKKSNLESSQKSDLL
KLWIKIWSITFRGISSGQTQTENFALLEAIIQGSLVELDREFWKLFTGSACKPSSPSVCC
LTLALSICVVPDAIEMGTEQSVCEANRSFSVKESIMRWLLFYQLEDDLEDSTELPPILQS
NFPHLVVEKILVSLTMKNSKAAMKFFQSVPECEQDCEDKEEPSFSEVEELFLQTTFDKME
FLTTVKENVVEKFQSRVGFSVQQNLKESLDHYLLGLSEQLLSNYSSEITSSETLVRCSSL
LVGVLGCYCYLGIMTEDEAHKSELFQKAKSLMQCAGESISLFKNKTNEESRIGSLRNVMH
LCTSCLCIHTKHTPNKIASGFFLRLLTSKLMNDIADICKSLASCTKKPLDHGEVRPGKDD
EDGGGCDSLMEAEGPSSTRLSRAYPASSVSDANDYGENQNAVGAMSPLAADYLSKQDHLL
LDMLRFLGRSVTASQSHTVSFRGADIRRKLLLLLDSSILDLTKPLHLHVYLVLLKDLPGS
EHSLPMEDVVELLQPLSLVCSLHRRDQDVCKTILSNVLHIVTNLGQGSVDMESTRIAQGH
FLTVMGAFWHLTKEKKCVFSVRMALVKCLQTLLEADPYSEWAILNVKGQDFPVNEAFPQF
LADDHHQVRMLAAGSVNRLFQDMRQGDFSRGLKALPLKFQQTSFNNAYTTAEAGIRELLC
DSQNPDLLDEIYNRKSVLLMMIAVVLHCSPVCEKQALFALCKSVKENRLEPHLVKKVLEK
VSESFGCRSLEDFMISHLDYLVLEWLNLQDTEYSLSSFPFMLLNYTRLEDFYRSCYKILI
PHLVIRSHFDEVKSIANQIQKCWKSLLVDCFPKILVHILPYFAYEGTRDSYVSQKRETAT
KVYDTLKGEDFLGKQIDQVFIGNLPEIVVELLMTLHETADSADSDASQSTAAFCDFSGDL
DPAPNPPYFPSHVIQATFAYISNCHKTKFKSILEILSKIPDSYQKILLAICEQAAETNNV
FKKHRILKIYHLFVSLLLKDIQSGLGGAWAFVLRDVIYTLIHYINKRSSHFTDVSLRSFS
LCCDLLSRVCHTAVTQCKDALESHLHVIVGTLIPLVDYQEVQEQVLDLLKYLVIDNKDNK
NLFVTIKLLDPFPDHVIFKDLRLTQQKIKYSGGPFSLLEEINHFLSVSAYNPLPLTRLEG
LKDLRRQLEQHKDQMLDLLRASQDNPQDGIVVKLVVSLLQLSKMAVNQTGEREVLEAVGR
CLGEIGPLDFSTIAVQHNKDVSYTKAYGLPEDRELQWTLIMLTALNNTLVEDSVKIRCAA
ATCLKNILATKTGHIFWENYKTSADPMLTYLQPFRTSRKKFLEVPRSVKEDVLEGLDAVN
LWVPQSESHDIWIKTLTCAFLDSGGINSEILQLLKPMCEAKTDFCQMLLPYLIHDVLLQD
THESWRTLLSAHVRGFFTSCFKHSSQASRSATPANSDSESESFLRCCLDKKSQRTMLAVV
DYLRRQKRPSSGTAFDDAFWLDLNYLEVAKVAQSCSAHFTALLYAEIYSDKKSTDEQEKR
SPTFEEGSQGTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRI
RTYEHEATWEKALVTYDLETSISSSTRQSGIIQALQNLGLSHILSVYLKGLDYERREWCA
ELQELRYQAAWRNMQWGLCASAGQEVEGTSYHESLYNALQCLRNREFSTFYESLRYARVK
EVEELSKGSLESVYSLYPTLSRLQAIGELENSGELFSRSVTDRERSEAYLKWQRHSQLLR
DSDFSFQEPLMALRTVILETLVQKDMESSQGACSKDILTKHLVEFSVLARTFKNTQLPEK
AIFKIKQYNSAICGISEWHLEEAQVFWAKKEQSLALSILKQMIKKLESSFKDKENDAGLK
VIYAECLRVCGSWLAETCLENPAVIMQTYLEKAVKVAGSYDGNSRELRNGQMKAFLSLAR
FSDTQYQRIENYMKSSEFENKQTLLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECAL
RALREDRKRFLCKAVENYINCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMKKDGMKIS
SYKFLPLMYQLAARMGTKMTGGLGFHEVLNNLISRISLDHPHHTLFIILALANANKDEFL
SKAETTRRSRISKSTSKENAHLDEDRTEAATRIIHSIRSKRCKMVKDMEALCDAYIILAN
MDASQWRAQRKGINIPANQPITKLKNLEDVVVPTMEIKVDPTGEYENLVTIKSFKTEFRL
AGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTI
CTYKVVPLSQRSGVLEWCTGTVPIGEYLVNSEEGAHRRYRPNDFSANQCQKKMMEVQKKS
FEEKYDTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRH
VQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCE
KTMEVMRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESDLHSTPNADDQECK
QSLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGW
KAWV
NT seq 9195 nt   +upstreamnt  +downstreamnt
atgagtctagcactaaatgatctgctcatttgctgccggcagttagagcatgacagagct
acagaacgaaggaaagaagtggataaatttaagcgcctgattcaggatcctgaaacagtt
caacatttagataggcattctgattccaaacaaggaaaatatctgaattgggatgctgtt
ttcaggtttttacagaagtacattcaaaaagaaacggaaagtctgagaacagcaaagtca
aatgtatcagccaccacacagagctccagacagaagaagatgcaagagatcagcagtttg
gtcagatacttcatcaaatgtgcaaacagaagagcacccaggctaaaatgtcaagacctc
ttgaattatgtcatggatacagtgaaagattcatctaatggtgtaacttatggagctgac
tgtagcaacatactactcaaagacattctttctgtgagaaaatactggtgtgaagtatct
cagcaacagtggctagaattgttttcactgtacttcaggctgtatctcaagccatcacag
gacattaatagagttttagtggctagaataattcatgctgtcaccagaggatgctgttca
cagactgatggattaccttcaaagtttttagatcttttttccaaggctattcagtatgcc
agacaagaaaagagctctcctggcttaagtcacatcttagcagcccttaacattttcctc
aagactctggctgtcaacttccgaaaacaggtgtgcgaagtaggagatgaaattcttcct
accttactatatatttggactcagcatagacttaatgattctttaaaagaagtaattatt
gaactaattcagctgcagatttatatccatcatccacaaggagccagagcccctgaagaa
ggtgcttacgaatccatgaaatggaaaagtatcttgtacaacttatatgacttgctagtg
aatgagataagccatataggaagtcgagggaagtattcttcaggatctcgtaatattgct
gtcaaggaaaatctgattgacctgatggcagatatctgttaccagctttttgatgcagat
accagatccgtggagatttctcaatcttatgtgacacaaagggaatccactgattacagt
gtaccttgcaaaagaaggaaaatagacgtaggctgggaagtgataaaagataatcttcag
aagtcacagaatgattttgatcttgtgccttggctacagattacaacccgattaatatca
aaatatccttccagtttacctaactgtgagctgtctccattaatactgatactgtaccag
cttctgactcaacagcgacgtggagaacgcatcccatatgtgttacggtgccttaaggaa
gttgccttatgtcaaggcaagaaatcaaacctagaaagctctcagaagtctgatttattg
aaactatggattaaaatttggtctattacctttcgtggaataagttctggacaaacacaa
actgaaaactttgctttacttgaggccatcattcaaggtagtttagttgaacttgacaga
gaattctggaagttatttactggctcagcctgtaaaccttcaagtccttcagtatgctgc
ttgactttggcacttagcatctgtgtagttccagatgcaatagaaatgggaacagaacaa
agtgtgtgtgaagcaaatagaagtttttctgtcaaggagtcaataatgaggtggctcttg
ttctatcagttggaggatgacttagaagacagcacagagctgcctccaattcttcagagt
aattttcctcatcttgtagtggaaaaaattcttgtaagtctcactatgaaaaactcaaaa
gctgcaatgaagttttttcaaagtgtgccagaatgtgaacaagactgcgaagataaagaa
gagccttcattttcagaagtagaggaactgtttcttcagacgacttttgacaagatggag
tttttaactactgtcaaagagaatgttgtagaaaaatttcagtctagggttggcttctct
gtccagcaaaatctcaaggaatcattggatcactatcttctgggattatcagaacagctt
ttaagtaattactcttctgagattacaagttctgaaacccttgtccggtgttcaagtctt
ttggtgggtgttcttggctgctattgttacctgggtataatgactgaggacgaagcccat
aaatcagaattattccagaaagccaagtctctgatgcaatgtgcaggagaaagtatctct
ctgtttaaaaataaaacaaatgaggaatcaagaattggttcattgagaaatgtgatgcat
ctgtgtacaagctgcttgtgtatacacaccaagcatacgccaaataagattgcctctggc
tttttcctacgattattgacatcaaagcttatgaatgacattgcagatatttgtaaaagt
ttagcatcctgtacgaaaaagccactggatcacggagaagtacgtccagggaaagatgat
gaagatggtggtggttgtgacagtctgatggaggcagagggtccatcatccactcgtctt
tctagggcttaccctgctagttctgtgagcgatgcaaatgattatggagagaaccagaat
gctgttggtgccatgagtcctttagctgccgactacctgtccaaacaagatcatcttctc
ttagacatgctcaggttcttaggccgatctgtaactgcatctcagagccatactgtgtcg
tttagaggagctgacataagaagaaaattgttactgttgcttgattctagcatactcgat
ctcacgaaacccctccacctgcatgtgtacttagtgctcctgaaggatctccctggaagc
gagcattcattgccaatggaggatgttgttgaacttctgcaaccattatcccttgtgtgt
tctctgcatcgacgtgaccaagatgtctgtaaaacgattctaagcaatgtccttcatata
gtgacaaacctaggccagggcagtgtggacatggagagcacacggattgctcaaggacac
ttcctgacagtgatgggagcattttggcatttgacaaaggaaaagaaatgtgtattctct
gtaagaatggcattagtaaagtgtcttcaaacactgcttgaggccgatccatattccgaa
tgggcaattcttaatgtaaagggacaagactttcctgtaaatgaagcttttccacagttt
cttgctgacgatcatcatcaagttcggatgttggctgcagggtcagtcaacagattattt
caggatatgagacaaggcgatttctccagaggcttgaaagcacttcctctgaagtttcag
cagacatcttttaacaatgcatacacgacagcagaggcgggaatcagagaactgttatgc
gattctcagaaccctgatcttctggatgagatctataacagaaaatctgtactactgatg
atgatagctgtggtcttgcactgtagcccagtctgtgaaaaacaggctttgtttgcttta
tgcaagtctgtgaaggaaaacagattagaacctcatcttgtgaaaaaggttttagagaaa
gtctccgaatcgtttggatgtagaagtttagaagacttcatgatttctcacctagactac
ctggttttggaatggctgaaccttcaagatactgaatatagcttatcttcttttcctttt
atgttattaaactacacacgccttgaggatttctatcgatcttgttacaagattttgatc
ccacatttggtaatcagaagccattttgatgaggtgaagtccattgctaatcagattcaa
aagtgctggaaaagcctgttggtagattgctttccgaagattcttgtgcacatccttcct
tactttgcctacgagggcacgagagacagctacgtatcacagaagagagagactgctacc
aaggtctacgatactcttaaaggggaagacttcctaggaaaacagattgaccaagtattc
attggtaatttgccagagattgtggtggagttgctgatgacattgcatgagacagctgac
tcagcggactcggacgccagtcaaagcaccgccgccttctgtgatttttcaggggatttg
gatcctgcccccaacccaccatatttcccctcacatgtcattcaggcaacgtttgcttac
atcagcaactgtcataaaaccaagtttaaaagcattctagaaattctttctaaaatccct
gattcctatcagaaaatacttctggccatttgtgaacaagcagctgagacaaataatgtc
tttaaaaagcacagaattcttaaaatatatcacctgtttgttagtttattactgaaagat
atacagagtggcctgggaggggcttgggcctttgtccttcgcgatgttatttatactctg
attcactacatcaacaaaaggtcttctcatttcacagatgtgtccttgcgtagcttttcc
ctttgctgtgacctattaagtcgagtttgtcatacagctgtaactcaatgtaaggatgct
ctagaaagccatcttcacgttatcgttggcacacttattccccttgtggattatcaggaa
gttcaagaacaggtattggacctgttgaagtacttagtgatagataacaaagacaataaa
aacctctttgtcacaattaagcttttggatccttttcctgaccatgttatttttaaggat
ttgcgtcttactcaacagaaaatcaaatatagtggaggacctttttcactcttagaggaa
ataaaccattttctctcagtaagtgcttataatccacttccgctgaccaggcttgaagga
ctgaaggatcttcgaagacaactggaacaacataaagatcagatgctagatcttctcaga
gcatctcaggataacccacaagatggcattgtggtgaagctagttgtcagcctgttgcag
ttatccaagatggcagtgaaccagactggtgaaagagaagttctagaggctgtcggaagg
tgtttgggagaaataggccctctggatttctccaccatagctgtacagcataacaaagat
gtgtcctataccaaagcctacgggttacctgaagacagagaacttcagtggaccttgata
atgctgactgccctcaacaataccctggtagaggacagtgtcaaaattcgatgtgctgct
gctacctgtttgaaaaacattttggctacaaagactggacatattttctgggagaattat
aagacatcagcggatccaatgctgacctatctacaaccttttagaacatcgaggaaaaag
tttttagaagtgccccgatctgttaaagaagatgttttagaaggcctggatgctgtgaat
ctgtgggttcctcaaagtgaaagtcatgacatttggataaagacactgacgtgtgccttt
ctggacagtggaggcataaacagtgaaattctccagttattaaagccaatgtgtgaagcg
aaaaccgacttctgtcagatgttgctgccatacttgatccatgatgttttactccaagat
acacatgaatcgtggagaactctgctgtctgcgcatgtccgaggatttttcactagttgt
tttaagcattcctcccaagcaagccgctcagcaactcctgcaaattcggattcagagtca
gagagctttctccgatgctgtttggataaaaagtcacaaagaaccatgcttgctgttgtc
gactatctgagaaggcaaaagagaccttcctcgggaacagcctttgatgacgctttctgg
ctggatttgaattatcttgaggttgcgaaggtggctcagtcctgctctgctcacttcacg
gccttgctctacgcagagatctattcagataagaaaagcacagacgagcaagagaaaaga
agtccaacatttgaagaaggaagtcaaggtacaactatttctagtttgagtgaaaaaagt
aaagaagaaactggaataagcttacaggatcttctcttagagatctacagaagtatagga
gagccggacagcctgtatggctgtggaggagggaaaatgttacaaccccttactagaata
cggacctatgaacatgaagcaacgtgggagaaagccttagtaacttatgacctggagacc
agcatctcctcctccacccgccagtcaggaatcatccaggccctgcagaatttggggctc
tcccatatcctgtctgtctatctgaaaggattagactatgaaagacgagagtggtgcgct
gagctgcaggagctgcgttaccaggcggcgtggaggaacatgcagtggggcctctgcgct
tctgccggccaagaagtagaaggaaccagttaccatgaatcattgtataatgctctgcag
tgtctaagaaacagagaattctccacattttatgaaagcctccgatatgccagggtgaaa
gaagttgaagagttgagtaagggcagccttgagtctgtgtattcgctgtatcccacactt
agtagattgcaggcaattggagaactggaaaacagtggcgagcttttctcaaggtcagtc
acagacagagagcgctctgaagcatacttgaagtggcagaggcactcccagcttctgaga
gacagtgacttcagctttcaggagcctctcatggctctacgcacagtcattctggagacc
ctggtacagaaggacatggagagctctcaaggagcatgctctaaggacattctcaccaaa
caccttgttgaattctctgttctggctcgaaccttcaagaacacacagctccctgaaaaa
gcaatattcaaaattaagcaatataattcagctatttgtggaatttctgagtggcatttg
gaagaagcacaagtattctgggcaaaaaaggagcagagtcttgctctgagtattctcaag
cagatgatcaagaagttggaatccagctttaaagataaagagaatgatgctggtctcaaa
gtcatatacgctgagtgtctaagggtttgtggcagctggctggcagaaacttgcttagaa
aaccctgcagtcatcatgcagacctatctagaaaaggcagtgaaggttgctggaagttac
gatggcaacagcagagagctcagaaatggacagatgaaggcctttctctcattggcaagg
ttctctgatactcagtaccagagaattgaaaactacatgaagtcatcagaatttgaaaac
aagcaaactctcttaaaaagagccaaagaggaagtgggccttctaagggaacataaaatt
cagaccaacagatacacagtaaaggttcagagagaactggagctggacgaatgtgctctc
cgtgcactgagagaggatcgcaagcgtttcctgtgtaaagcagtggagaactacatcaac
tgcttactaagtggggaagagcatgatctgtgggtgttccggctttgctccctctggctt
gaaaattctggagtttctgaagtcaatggcatgatgaagaaagatggaatgaagatttca
tcctataagtttttgcctctcatgtatcaattggctgctcgaatggggaccaaaatgacg
ggaggcttaggatttcatgaggtcctcaataatctaatctctaggatctcactggatcac
ccccatcatactttgttcattatactggccttagcaaatgcgaacaaagatgaatttttg
agcaaagcagagacaacaagaaggagtcgaataagcaaaagcacatctaaagaaaacgct
caccttgatgaggatcgaacagaggctgcaaccagaatcatccactccatcagaagtaag
cgatgtaagatggtgaaggacatggaggcgctctgcgatgcctacatcatattggcaaac
atggatgcctctcagtggagggctcagagaaaaggcatcaatattccagccaaccaacca
atcactaaactgaaaaatttagaagatgttgttgttcccactatggaaattaaggttgat
cccacaggagagtatgaaaatttggtgactataaaatcatttaaaacagaatttcgctta
gccggaggcttaaatttacccaaaataatagattgtgtgggttctgatggcaaggaaagg
agacagcttgtgaagggccgcgatgacctgaggcaagatgctgtcatgcagcaggttttc
cagatgtgcaatacactactgcagagaaacaccgagactagaaagaggaaactgactatc
tgcacatacaaggtggttcccctttctcagcgaagcggtgttctcgagtggtgcacagga
accgttcctattggtgaatatcttgttaacagcgaagaaggtgcacatagaagatacagg
ccaaatgatttcagcgccaatcagtgccaaaagaaaatgatggaagtgcagaagaagtct
tttgaagagaaatatgatactttcatgactatttgccaaaactttgaaccagttttccgt
tacttctgcatggaaaaattcttggacccagctgtttggtttgagaaacgattggcatat
acgcgtagtgtggccacatcttctatcgtcggttacatccttggacttggcgacaggcac
gtacagaatatcttgataaacgagcagtcggcagagcttgtgcacatagatctgggagtg
gcctttgaacaggggaagatccttcccactccagaaacagttccttttagactcagcaga
gatattgtggacgggatgggcatcaccggtgtggaaggtgtcttcaggaggtgctgtgaa
aaaacgatggaagttatgcgtagttctcaggaaaccctgctgaccatcgtagaggtcctt
ttgtatgatccgctctttgattggactatgaatcctttaaaagctctgtatctacagcag
aggccagaagatgagtccgacctccattccacccccaatgcagatgatcaagaatgcaaa
caaagtcttagtgatactgaccagagtttcaacaaagtagctgagcgtgtcttgatgagg
ttgcaagagaaactgaaaggcgtggaggaaggcactgtgctcagtgtgggtggacaggtg
aacttgcttatccagcaggccatggatcccaaaaatctcagccgactcttcccaggatgg
aaagcttgggtgtga

DBGET integrated database retrieval system