KEGG   Mus caroli (Ryukyu mouse): 110301468
Entry
110301468         CDS       T05910                                 

Gene name
Rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal04390  Hippo signaling pathway
mcal04392  Hippo signaling pathway - multiple species
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05219  Bladder cancer
mcal05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110301468 (Rassf1)
   04390 Hippo signaling pathway
    110301468 (Rassf1)
   04392 Hippo signaling pathway - multiple species
    110301468 (Rassf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301468 (Rassf1)
   05206 MicroRNAs in cancer
    110301468 (Rassf1)
  09162 Cancer: specific types
   05219 Bladder cancer
    110301468 (Rassf1)
   05223 Non-small cell lung cancer
    110301468 (Rassf1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 110301468
NCBI-ProteinID: XP_021027594
Ensembl: MGP_CAROLIEiJ_G0032648
LinkDB
Position
9
AA seq 270 aa
MGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLVRRPRRDQDEAVERETPDL
SQAETEQKIKDYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARR
GTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKFMVVDDPRKFALFERTER
HGQVYLRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRILQR
EEEEHLRQILQKYSRCRQKIQEALHACPLG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcgaggctgaaacaccttccttcgaaatgacctggagcagcacgaccagcagtggc
tactgcagccaggaggactcggactcggagctcgagcagtacttcacggcgcgtacctcg
ctggtccgcaggccgcgccgggaccaggatgaggctgtagagcgggagacacccgatctt
tctcaagctgagactgagcagaaaatcaaggactacaatggccagatcaacagcaacctc
ttcatgagcctgaataaggatggctcctacacaggcttcatcaaggttcagctgaaacta
gtgcgtcctgtttcagtgccttccagcaagaaaccaccttccttacaggacgcccggaga
ggtacggggcggagcacagccgtgaagcgccgcacctctttttacttgcctaaggatgct
attaagcatctgcatgttctatcacgaacgcgggcacgtgaggtcattgaggccctgctt
cgaaaattcatggtcgtagatgatcctcgcaagtttgcactctttgagcgaactgaacgg
catggccaagtatacctccggaagctgtcggatgacgagcagcccttgaagctgcggctt
cttgcagggcccagtgaaaaagccctgagctttgtcctgaaggagaatgactcgggagag
gtgaactgggatgccttcagcatgcctgaactgcacaatttcctacgcatcctgcagcgg
gaagaagaggaacaccttcgccagatcctgcagaagtattctcgttgtcgccagaagatc
caggaggctctgcacgcctgtcctttggggtga

DBGET integrated database retrieval system