KEGG   Mus caroli (Ryukyu mouse): 110301502
Entry
110301502         CDS       T05910                                 

Gene name
Map2k1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04114  Oocyte meiosis
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal04270  Vascular smooth muscle contraction
mcal04370  VEGF signaling pathway
mcal04371  Apelin signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04668  TNF signaling pathway
mcal04720  Long-term potentiation
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05034  Alcoholism
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110301502 (Map2k1)
   04012 ErbB signaling pathway
    110301502 (Map2k1)
   04014 Ras signaling pathway
    110301502 (Map2k1)
   04015 Rap1 signaling pathway
    110301502 (Map2k1)
   04370 VEGF signaling pathway
    110301502 (Map2k1)
   04371 Apelin signaling pathway
    110301502 (Map2k1)
   04668 TNF signaling pathway
    110301502 (Map2k1)
   04066 HIF-1 signaling pathway
    110301502 (Map2k1)
   04068 FoxO signaling pathway
    110301502 (Map2k1)
   04072 Phospholipase D signaling pathway
    110301502 (Map2k1)
   04071 Sphingolipid signaling pathway
    110301502 (Map2k1)
   04024 cAMP signaling pathway
    110301502 (Map2k1)
   04022 cGMP-PKG signaling pathway
    110301502 (Map2k1)
   04151 PI3K-Akt signaling pathway
    110301502 (Map2k1)
   04150 mTOR signaling pathway
    110301502 (Map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110301502 (Map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110301502 (Map2k1)
   04210 Apoptosis
    110301502 (Map2k1)
   04218 Cellular senescence
    110301502 (Map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110301502 (Map2k1)
   04540 Gap junction
    110301502 (Map2k1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110301502 (Map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110301502 (Map2k1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110301502 (Map2k1)
   04620 Toll-like receptor signaling pathway
    110301502 (Map2k1)
   04650 Natural killer cell mediated cytotoxicity
    110301502 (Map2k1)
   04660 T cell receptor signaling pathway
    110301502 (Map2k1)
   04662 B cell receptor signaling pathway
    110301502 (Map2k1)
   04664 Fc epsilon RI signaling pathway
    110301502 (Map2k1)
   04666 Fc gamma R-mediated phagocytosis
    110301502 (Map2k1)
   04062 Chemokine signaling pathway
    110301502 (Map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110301502 (Map2k1)
   04929 GnRH secretion
    110301502 (Map2k1)
   04912 GnRH signaling pathway
    110301502 (Map2k1)
   04915 Estrogen signaling pathway
    110301502 (Map2k1)
   04914 Progesterone-mediated oocyte maturation
    110301502 (Map2k1)
   04917 Prolactin signaling pathway
    110301502 (Map2k1)
   04921 Oxytocin signaling pathway
    110301502 (Map2k1)
   04926 Relaxin signaling pathway
    110301502 (Map2k1)
   04935 Growth hormone synthesis, secretion and action
    110301502 (Map2k1)
   04919 Thyroid hormone signaling pathway
    110301502 (Map2k1)
   04928 Parathyroid hormone synthesis, secretion and action
    110301502 (Map2k1)
   04916 Melanogenesis
    110301502 (Map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110301502 (Map2k1)
  09156 Nervous system
   04725 Cholinergic synapse
    110301502 (Map2k1)
   04726 Serotonergic synapse
    110301502 (Map2k1)
   04720 Long-term potentiation
    110301502 (Map2k1)
   04730 Long-term depression
    110301502 (Map2k1)
   04722 Neurotrophin signaling pathway
    110301502 (Map2k1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110301502 (Map2k1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301502 (Map2k1)
   05206 MicroRNAs in cancer
    110301502 (Map2k1)
   05205 Proteoglycans in cancer
    110301502 (Map2k1)
   05230 Central carbon metabolism in cancer
    110301502 (Map2k1)
   05231 Choline metabolism in cancer
    110301502 (Map2k1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110301502 (Map2k1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110301502 (Map2k1)
   05212 Pancreatic cancer
    110301502 (Map2k1)
   05225 Hepatocellular carcinoma
    110301502 (Map2k1)
   05226 Gastric cancer
    110301502 (Map2k1)
   05214 Glioma
    110301502 (Map2k1)
   05216 Thyroid cancer
    110301502 (Map2k1)
   05221 Acute myeloid leukemia
    110301502 (Map2k1)
   05220 Chronic myeloid leukemia
    110301502 (Map2k1)
   05218 Melanoma
    110301502 (Map2k1)
   05211 Renal cell carcinoma
    110301502 (Map2k1)
   05219 Bladder cancer
    110301502 (Map2k1)
   05215 Prostate cancer
    110301502 (Map2k1)
   05213 Endometrial cancer
    110301502 (Map2k1)
   05224 Breast cancer
    110301502 (Map2k1)
   05223 Non-small cell lung cancer
    110301502 (Map2k1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110301502 (Map2k1)
   05022 Pathways of neurodegeneration - multiple diseases
    110301502 (Map2k1)
  09165 Substance dependence
   05034 Alcoholism
    110301502 (Map2k1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110301502 (Map2k1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110301502 (Map2k1)
   05135 Yersinia infection
    110301502 (Map2k1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110301502 (Map2k1)
   05170 Human immunodeficiency virus 1 infection
    110301502 (Map2k1)
   05161 Hepatitis B
    110301502 (Map2k1)
   05160 Hepatitis C
    110301502 (Map2k1)
   05164 Influenza A
    110301502 (Map2k1)
   05163 Human cytomegalovirus infection
    110301502 (Map2k1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110301502 (Map2k1)
   05165 Human papillomavirus infection
    110301502 (Map2k1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110301502 (Map2k1)
   01522 Endocrine resistance
    110301502 (Map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110301502 (Map2k1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110301502 (Map2k1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: STE group
  STE7 family
   110301502 (Map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 110301502
NCBI-ProteinID: XP_021027639
Ensembl: MGP_CAROLIEiJ_G0032341
UniProt: A0A6P5QC03
LinkDB
Position
9
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgatggctcggcggtt
aacgggaccagctcggccgagaccaacctggaggccttgcagaagaagctggaggagctg
gagcttgatgagcagcagcggaagcgccttgaggcctttctgacgcagaagcagaaggtg
ggagaactgaaggatgatgactttgagaagatcagcgaactgggagctggcaatggtgga
gtggtcttcaaggtctcccacaagccatctggcctggttatggctagaaagctgatccac
ctggagatcaaacccgcaatccggaaccagatcatccgggagctgcaggtgctgcacgag
tgcaactccccgtacattgtgggcttctacggggccttctacagcgacggcgagatcagc
atctgcatggagcacatggatggtgggtccttggatcaagttctgaagaaagctggaaga
attcctgagcaaattttaggaaaagttagcattgctgtgataaaaggcctgacctatctt
cgggagaagcacaagattatgcacagagatgtcaagccatccaacattctagtgaactca
cgtggggagatcaaactctgtgattttggggtcagcgggcagctaattgactctatggcc
aactccttcgtgggcacgaggtcctacatgtcgcctgagagactccaggggactcactac
tctgtgcagtcagacatctggagcatggggctctctctggtggagatggcagttgggaga
taccccattcctcctcctgatgccaaggagctggagctactgtttggatgccatgtggaa
ggagatgcagccgaaacaccacccaggccaaggacccctgggaggcctctcagctcatat
ggaatggatagccgacctcccatggcaatttttgagttgttggattacattgtcaatgag
cctcctccaaaactgcccagtggagtattcagtctggagtttcaggattttgtgaataaa
tgcttaataaagaaccctgcagagagagcagatctgaagcagctcatggtacatgctttc
atcaaaagatctgacgccgaggaggtagacttcgcaggctggctctgctccaccattggg
cttaaccagcccagcacaccaacccacgctgccagcatctga

KEGG   Mus caroli (Ryukyu mouse): 110303196
Entry
110303196         CDS       T05910                                 

Gene name
Map2k2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal04270  Vascular smooth muscle contraction
mcal04370  VEGF signaling pathway
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04720  Long-term potentiation
mcal04722  Neurotrophin signaling pathway
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04929  GnRH secretion
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110303196 (Map2k2)
   04012 ErbB signaling pathway
    110303196 (Map2k2)
   04014 Ras signaling pathway
    110303196 (Map2k2)
   04015 Rap1 signaling pathway
    110303196 (Map2k2)
   04370 VEGF signaling pathway
    110303196 (Map2k2)
   04371 Apelin signaling pathway
    110303196 (Map2k2)
   04066 HIF-1 signaling pathway
    110303196 (Map2k2)
   04068 FoxO signaling pathway
    110303196 (Map2k2)
   04072 Phospholipase D signaling pathway
    110303196 (Map2k2)
   04071 Sphingolipid signaling pathway
    110303196 (Map2k2)
   04024 cAMP signaling pathway
    110303196 (Map2k2)
   04022 cGMP-PKG signaling pathway
    110303196 (Map2k2)
   04151 PI3K-Akt signaling pathway
    110303196 (Map2k2)
   04150 mTOR signaling pathway
    110303196 (Map2k2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110303196 (Map2k2)
  09143 Cell growth and death
   04210 Apoptosis
    110303196 (Map2k2)
   04218 Cellular senescence
    110303196 (Map2k2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110303196 (Map2k2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110303196 (Map2k2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110303196 (Map2k2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110303196 (Map2k2)
   04620 Toll-like receptor signaling pathway
    110303196 (Map2k2)
   04650 Natural killer cell mediated cytotoxicity
    110303196 (Map2k2)
   04660 T cell receptor signaling pathway
    110303196 (Map2k2)
   04662 B cell receptor signaling pathway
    110303196 (Map2k2)
   04664 Fc epsilon RI signaling pathway
    110303196 (Map2k2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110303196 (Map2k2)
   04929 GnRH secretion
    110303196 (Map2k2)
   04912 GnRH signaling pathway
    110303196 (Map2k2)
   04915 Estrogen signaling pathway
    110303196 (Map2k2)
   04917 Prolactin signaling pathway
    110303196 (Map2k2)
   04921 Oxytocin signaling pathway
    110303196 (Map2k2)
   04926 Relaxin signaling pathway
    110303196 (Map2k2)
   04935 Growth hormone synthesis, secretion and action
    110303196 (Map2k2)
   04919 Thyroid hormone signaling pathway
    110303196 (Map2k2)
   04916 Melanogenesis
    110303196 (Map2k2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110303196 (Map2k2)
  09156 Nervous system
   04720 Long-term potentiation
    110303196 (Map2k2)
   04730 Long-term depression
    110303196 (Map2k2)
   04722 Neurotrophin signaling pathway
    110303196 (Map2k2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303196 (Map2k2)
   05206 MicroRNAs in cancer
    110303196 (Map2k2)
   05205 Proteoglycans in cancer
    110303196 (Map2k2)
   05230 Central carbon metabolism in cancer
    110303196 (Map2k2)
   05231 Choline metabolism in cancer
    110303196 (Map2k2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110303196 (Map2k2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110303196 (Map2k2)
   05225 Hepatocellular carcinoma
    110303196 (Map2k2)
   05226 Gastric cancer
    110303196 (Map2k2)
   05214 Glioma
    110303196 (Map2k2)
   05216 Thyroid cancer
    110303196 (Map2k2)
   05221 Acute myeloid leukemia
    110303196 (Map2k2)
   05220 Chronic myeloid leukemia
    110303196 (Map2k2)
   05218 Melanoma
    110303196 (Map2k2)
   05211 Renal cell carcinoma
    110303196 (Map2k2)
   05219 Bladder cancer
    110303196 (Map2k2)
   05215 Prostate cancer
    110303196 (Map2k2)
   05213 Endometrial cancer
    110303196 (Map2k2)
   05224 Breast cancer
    110303196 (Map2k2)
   05223 Non-small cell lung cancer
    110303196 (Map2k2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110303196 (Map2k2)
   05022 Pathways of neurodegeneration - multiple diseases
    110303196 (Map2k2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110303196 (Map2k2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110303196 (Map2k2)
   05135 Yersinia infection
    110303196 (Map2k2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110303196 (Map2k2)
   05170 Human immunodeficiency virus 1 infection
    110303196 (Map2k2)
   05161 Hepatitis B
    110303196 (Map2k2)
   05160 Hepatitis C
    110303196 (Map2k2)
   05164 Influenza A
    110303196 (Map2k2)
   05163 Human cytomegalovirus infection
    110303196 (Map2k2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110303196 (Map2k2)
   05165 Human papillomavirus infection
    110303196 (Map2k2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110303196 (Map2k2)
   01522 Endocrine resistance
    110303196 (Map2k2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110303196 (Map2k2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110303196 (Map2k2)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: STE group
  STE7 family
   110303196 (Map2k2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 110303196
NCBI-ProteinID: XP_021029857
Ensembl: MGP_CAROLIEiJ_G0015619
UniProt: A0A6P5QH89
LinkDB
Position
10
AA seq 401 aa
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRP
PGRPISVGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERAD
LKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTAV
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgttaccggcgctcactatcaatcctaccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaggcaaacctggtggacctccagaagaag
ctggaagagctggacctggatgagcagcagaggaaacggctggaggccttccttacccag
aaggctaaggtcggtgagctcaaggacgacgactttgagaggatctcagagctgggtgcc
ggcaatggtggagtggtcaccaaggcccggcataggccgtcaggcctcattatggccaga
aagctgatccacctggagatcaagccagccgtgcgcaaccagatcatccgggagctgcag
gtgctgcacgagtgcaactcgccctacatcgtgggcttctatggggccttctacagtgat
ggcgagatcagcatctgcatggagcacatggatggtggctcactggaccaggtactgaag
gaggccaagcggattcctgaagacatcttggggaaggtcagcattgcggtgctccggggc
ctggcctacctccgagagaagcaccagatcatgcacagagatgtgaagccctccaacatc
ctggtgaactctcgcggggagattaagctgtgcgacttcggggtgagcggccagctgatc
gactccatggccaactcgtttgtagggacacgctcctacatgtccccagagcggctgcag
ggcacccactactctgtgcagtcggacatctggagcatggggctgtcgctggtggagctg
gccatcgggaggtatcccattcccccacctgatgccaaggaactagaggccagctttggc
cggcctgtggtggacggggcagacggagaaccccatagtgtctccccgaggcccaggccc
cctggacgccccatcagtgtaggtcatgggatggacagccgaccggccatggccatcttt
gagctgctggactacatagtgaatgagccacctcccaagctgcccagtggtgtgttcagc
tcagacttccaggagtttgtgaataaatgtctcattaagaacccagcagagcgagcagat
ctgaagctgctgatgaaccacgccttcatcaagcgctctgagggggaggaagtggacttc
gccggctggctgtgcagaaccctgcggctgaagcagcccagcacacccacacggactgca
gtgtga

DBGET integrated database retrieval system