KEGG   Mus caroli (Ryukyu mouse): 110301565
Entry
110301565         CDS       T05910                                 

Gene name
Ikbke
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit epsilon isoform X1
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110301565 (Ikbke)
   04621 NOD-like receptor signaling pathway
    110301565 (Ikbke)
   04622 RIG-I-like receptor signaling pathway
    110301565 (Ikbke)
   04623 Cytosolic DNA-sensing pathway
    110301565 (Ikbke)
   04625 C-type lectin receptor signaling pathway
    110301565 (Ikbke)
   04657 IL-17 signaling pathway
    110301565 (Ikbke)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    110301565 (Ikbke)
   05160 Hepatitis C
    110301565 (Ikbke)
   05171 Coronavirus disease - COVID-19
    110301565 (Ikbke)
   05164 Influenza A
    110301565 (Ikbke)
   05162 Measles
    110301565 (Ikbke)
   05168 Herpes simplex virus 1 infection
    110301565 (Ikbke)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110301565 (Ikbke)
   05169 Epstein-Barr virus infection
    110301565 (Ikbke)
   05165 Human papillomavirus infection
    110301565 (Ikbke)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110301565 (Ikbke)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     110301565 (Ikbke)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   110301565 (Ikbke)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like zf-RING_9
Other DBs
NCBI-GeneID: 110301565
NCBI-ProteinID: XP_021027735
Ensembl: MGP_CAROLIEiJ_G0014570
UniProt: A0A6P5Q5T4
LinkDB
Position
1
AA seq 748 aa
MSTAGKTWDPRNPPKWLFVLFSQEEDSQAQEMQSTTNYLWHTDDLLGQGATASVYKARNK
KSGEVVAVKVFNSASYRRPPEVQVREFEVLRRLNHQNIVKLFAVEETGGSRQKVLIMEYC
SSGSLLSVLEDPENTFGLSEEEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEG
QSIYKLSDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGV
TLYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAISGTQKQENGPLEWSYSLPITCRL
SMGLQNQLVPILANILEVEQDKCWGFDQFFAETSDILQRTVIHVFSLPQAVLHHVYIHAH
NTIAIFLEAVYEQTNVTPKHQEYLFEGHPCVLEPSLSAQHIAHTAASSPLTLFSMSSDTP
KGLAFRDPALDVPKFVPKVDLQADYSTAKGVLGAGYQALWLARVLLDGQALMLRGLHWVL
EVLQDTCQQTLEVTRTALLYLSSSLGTERLSSGAEMPDVQELKEATELRSRLQTLSEVLS
KCSHNVTETQRSLSCLGEELLKNRNQSHEDNRSAQKIQCCLDKMHFIYKQFKKSRMRPGL
SYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQTYQVSLVTHGKRMRQVQRAQNHLHLIAH
SVATCNSEARGAQESLNKIFDQLLLDRASKQGAEVSPQPMAPHPGPDPKDLVFHMQELCN
DMKLLAFDLQDNNRLIERLHRVPSAPDV
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtctactgcaggtaagacatgggaccctaggaacccccccaaatggttgtttgttttg
ttttcccaggaagaagatagccaagcccaggagatgcagagtaccactaactacctgtgg
catactgatgacctgctagggcagggggccactgccagtgtgtacaaggcccgaaacaag
aaatctggggaggtggttgctgtaaaggtcttcaactcagccagctatcggcgacctcct
gaggttcaagtgagggagtttgaggtcctgcggaggctgaatcaccagaacatcgtgaag
ctattcgcagtggaggaaacgggaggcagccggcagaaggtgctaatcatggagtactgc
tccagtgggagcctgctgagcgtgctggaagaccctgagaacacgttcgggctttctgaa
gaggagttcctagtggtactgcgctgtgtggtggctggcatgaaccacctgcgggagaat
ggcattgtccaccgggacatcaaacctgggaacatcatgcgcctggtgggtgaggagggg
cagagcatctataagctgtctgactttggggctgcccgcgagctggacgacgatgagaag
tttgtttctgtctatggtacagaggaatacctgcaccctgacatgtatgagcgtgcagtg
ctgcgcaaaccccagcaaaaggcatttggggtgactgtggatctctggagtattggggtg
accctgtaccacgcagccacaggcagtctgcccttcatccccttcggtgggccccggcga
aacaaggagatcatgtacagaatcaccacagagaagccagctggggccatttcagggact
cagaagcaggaaaatggtcccttggagtggagctacagcctccccatcacctgtagactg
tccatggggctgcagaaccagctggtacccattctggccaacatcctggaggtggaacag
gataagtgctggggctttgatcagttctttgcggagaccagtgacatcctgcagcgaaca
gtcatccacgtcttttccctaccccaggcggttttgcatcatgtctacatccacgcccac
aacacgattgccatctttttggaggctgtatatgagcagaccaatgtgacccccaaacac
caggagtacctcttcgagggtcacccttgtgtccttgagccaagcctctcagcccagcac
atcgcccacacagctgccagcagccctctaactctgttcagcatgtccagcgacacacct
aaggggctggccttcagggaccctgctctggatgtcccaaagttcgtccctaaggttgac
ctacaggctgattacagcacagctaagggggtgctgggcgctggctatcaggccctgtgg
ctggcgcgggtcctgctggatggacaggcattgatgcttcgggggttacactgggtcctg
gaggtgcttcaggacacgtgccagcagacactggaggtcacacggacagccctcctctac
ctcagcagcagcctgggcactgaaaggctcagcagtggagcagagatgcctgacgtccag
gaactaaaggaggccacagagctgagatccaggctgcagactctctcagaggtcctgtct
aaatgttcccacaatgtcacagaaacccaaaggagcctgagctgtctgggtgaagagctt
ttaaagaaccggaatcagagccatgaagataacagaagcgcccagaagattcagtgttgt
ttggacaaaatgcacttcatctacaaacagttcaagaaatccaggatgaggccagggctc
agctacaatgaggagcagatccacaagctggataaggtaaatttcagccatctagccaag
aggctgctgcaggtgttccaggaggagtgtgtgcagacgtatcaggtgtcgctggtcaca
cacggcaagcggatgaggcaggtgcagagggcccagaaccacctgcatctcattgcccac
tctgtggccacctgtaactcggaagccaggggagcccaggagagtctgaacaagatcttt
gatcagctccttctggacagagcttccaaacagggagctgaggtgtcaccacaacctatg
gctcctcatcccggccctgatccgaaggacctggtcttccacatgcaggagctttgtaat
gatatgaagctattggcctttgatctccaggacaacaaccgactcatcgaacggttacat
agagttccatcagcaccagatgtctga

DBGET integrated database retrieval system