KEGG   Mus caroli (Ryukyu mouse): 110301682
Entry
110301682         CDS       T05910                                 

Gene name
Dapk2
Definition
(RefSeq) death-associated protein kinase 2
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04140  Autophagy - animal
mcal05200  Pathways in cancer
mcal05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110301682 (Dapk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301682 (Dapk2)
  09162 Cancer: specific types
   05219 Bladder cancer
    110301682 (Dapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110301682 (Dapk2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110301682 (Dapk2)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   110301682 (Dapk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kdo Glycos_trans_3N
Other DBs
NCBI-GeneID: 110301682
NCBI-ProteinID: XP_021027922
Ensembl: MGP_CAROLIEiJ_G0032377
UniProt: A0A6P5QCP5
LinkDB
Position
9
AA seq 370 aa
MVQASMRSPNMETFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR
ASRRGVCREEIEREVSILRQVLHPNIITLHDVYENRTDVVLILELVSGGELFDFLAQKES
LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED
GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT
AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDTQQAMVRRESV
VNLENFKKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRTSEDLRNCESDTEENIARRKA
LHPRRRSSTS
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggtccaggcctcgatgaggagcccaaatatggagacgttcaaacagcagaaggtggag
gacttttatgacatcggagaggagctgggcagtggccagtttgccatcgtgaagaagtgc
cgggagaagagcacggggctggagtatgcagctaagttcatcaagaagaggcagagccgg
gccagccgtcggggcgtgtgccgggaggaaatcgagcgggaggtgagcatcctgcggcag
gtgctgcaccccaacatcatcacgctgcacgacgtctatgagaaccgcaccgacgtggtg
ctcatccttgagctagtgtccggaggagaactgtttgatttcctggcccagaaggagtcg
ttaagtgaggaggaagccaccagcttcattaagcagatcctggatggggtgaattacctt
cacacaaagaaaattgctcactttgatctcaagccagaaaacatcatgttgttagacaag
aatatccccattccacacatcaagctgattgactttggcctggctcatgaaatagaagat
ggagttgaatttaaaaacatttttgggactcctgaatttgttgctccagaaatcgtgaac
tatgagccactgggactggaggctgacatgtggagcattggagtcatcacctacatcctt
ctaagtggagcgtcccccttcctgggagacacaaaacaagaaaccctggcaaatatcact
gctgtgagttacgactttgatgaggaattcttcagccagacaagcgagctggccaaggac
ttcattcggaagcttcttgtgaaagagacccggaaacggcttaccatccaagaggctctc
agacatccctggatcacgccggtggacacccagcaagctatggtgcgcagagagtccgtg
gtcaacctggagaattttaagaagcagtatgtccgcaggaggtggaagctgtccttcagc
attgtctccttgtgcaaccacctcactcgctccctgatgaagaaggtccatttgaggaca
agcgaggacctgaggaactgtgagagtgacacagaggagaacatcgccaggaggaaagcc
cttcacccccggagaaggagcagtacctcctaa

KEGG   Mus caroli (Ryukyu mouse): 110303111
Entry
110303111         CDS       T05910                                 

Gene name
Dapk3
Definition
(RefSeq) death-associated protein kinase 3 isoform X1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04140  Autophagy - animal
mcal05200  Pathways in cancer
mcal05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110303111 (Dapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303111 (Dapk3)
  09162 Cancer: specific types
   05219 Bladder cancer
    110303111 (Dapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110303111 (Dapk3)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110303111 (Dapk3)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   110303111 (Dapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Choline_kinase
Other DBs
NCBI-GeneID: 110303111
NCBI-ProteinID: XP_021029706
Ensembl: MGP_CAROLIEiJ_G0015624
UniProt: A0A6P5QIH5
LinkDB
Position
10
AA seq 483 aa
MPSQDLYQRFSLAPGGDSMAEDAPVSPESFRRPAAMSTFRQEDVEDHYEMGEELGSGQFA
IVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIRHPNIITLHDVFEN
KTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENI
MLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGV
ITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMT
IAQSLEHSWIKVRRREDGARKPERRRLRAARLREYSLKSHSSMPRNTSYASFERFSRVLE
DVAAAEQGLRELQRGRRQCRERVCALRAAAEQREARCRDGSAGLGRDLRRLRTELGRTEA
LRTRAQEEARAALLGAGGLKRRLCRLENRYDALAAQVAAEVQFVRDLVRALEQERLQAEC
GVR
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgccgtctcaggatttgtaccagaggttctcgctggcaccgggcggggactcgatggct
gaggacgctcctgtgtccccagaatccttcagaaggccagctgccatgtccacattcagg
caagaggatgttgaggaccattatgagatgggagaggagcttggcagtggccaatttgcc
atcgtgcgcaagtgccagcagaagggcacgggcatggagtatgcagccaagttcatcaag
aagagacgcctgccatccagccggcgcggtgtaagccgggaggagatcgagcgtgaggtg
agcatcctgcgcgagatccgccaccctaacatcattacactgcatgacgtgttcgagaac
aagacagatgtggtgctgatcctggagctggtgtccggtggcgagctgttcgacttcctg
gccgagaaagagtcactgacggaggatgaggccacgcagttcctcaaacagatcctagac
ggtgtccactacctgcactccaagcgcatcgcacactttgacctgaagcctgagaacatc
atgttgctggacaagcacgcggccagcccgcgcattaagctcatcgactttggcatcgcg
cacagaatcgaggccggcagcgagttcaagaacatctttggcacacccgagtttgtcgcc
cccgagattgtcaactatgagccacttggcttggaggctgacatgtggagcatcggcgtc
atcacctacatcctcctgagcggagcgtccccattcctgggtgagaccaagcaggagacg
ctaacgaacatctcggcagtgaactatgactttgatgaggaatacttcagcagcaccagc
gagctggccaaggacttcatccgcaggctgctggtcaaagaccccaagaggaggatgacc
atcgcacagagcctggagcattcctggatcaaggtgcgcaggcgcgaggacggcgcccgg
aagccagagcgacggcggctgcgcgccgcacgcctgcgcgagtacagcctcaagtcccac
tcgagcatgccgcgcaacacgagctacgccagcttcgagcgcttctcacgcgtgctggag
gacgtggcggcggcagagcaggggctgcgcgagctgcagcgaggcaggcgccagtgccgg
gagcgcgtgtgtgcgctgcgcgcggccgccgagcagcgggaggcgcgctgccgcgacggg
agcgcagggttagggcgcgacctgcgacgcctgcgcaccgagctggggcgcaccgaggct
ctgcgcacgcgcgcgcaggaggaggcgcgggcggcgctgttgggtgccgggggcctgaag
cgtcgcctgtgtcgcctggagaaccgttacgacgcgctagccgcgcaggtggccgctgag
gtgcaattcgtgcgcgacctggtgcgtgcgctggagcaggaacggctgcaggctgaatgc
ggcgtgcgctag

KEGG   Mus caroli (Ryukyu mouse): 110307645
Entry
110307645         CDS       T05910                                 

Gene name
Dapk1
Definition
(RefSeq) death-associated protein kinase 1 isoform X1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04140  Autophagy - animal
mcal05200  Pathways in cancer
mcal05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110307645 (Dapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110307645 (Dapk1)
  09162 Cancer: specific types
   05219 Bladder cancer
    110307645 (Dapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110307645 (Dapk1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110307645 (Dapk1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   110307645 (Dapk1)
SSDB
Motif
Pfam: Pkinase Ank_2 Ank_5 Ank_4 Ank PK_Tyr_Ser-Thr Ank_3 Death COR Kdo RIO1 O_Spanin_T7 AAA_29 ABC_tran APH AAA_23 Choline_kinase RsgA_GTPase Thg1C
Other DBs
NCBI-GeneID: 110307645
NCBI-ProteinID: XP_021035538
Ensembl: MGP_CAROLIEiJ_G0018615
UniProt: A0A6P7QDF8
LinkDB
Position
13
AA seq 1442 aa
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIRHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILSGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYDFEEEF
FRNTSTLAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSSYDVNQPNKHGTPPLLIAAGCGNIQMLQLLIKRGSRIDVQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPDFQDKEEET
PLHCAAWHGYYSVAKALCEVGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAS
DKDGHIALHLAVRRCQMEVIKTLLGHGCFVDFQDRHGNTPLHVACKDGSAPIVVALCEAS
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGANVEALTSDGKTAEDLAKAEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKSTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLAAKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
SHHLHCSTDDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHIIVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVVLVATHADIMNIPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHVSNKLFVLDAGASGSKDIKVLRNHLQEIRSQIVSGCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEDDLRHIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDSLQRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVSGCRIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIETVMATTLPGLLTVKHYLSPQQLREHHEPVMVYQPRDFFRA
QTLKESSLTNTMGGYKESFSSITCFGCHDVYSQASLGMDIHASDLSLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDMVAKHNVNNRASRDFLPSPVHALLQEWTSYPESTVGILISKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSRRDSHAWTPLY
DL
NT seq 4329 nt   +upstreamnt  +downstreamnt
atgactgtgttcaggcaggaaaacgtggacgactactacgacaccggcgaggaactgggc
agtggacagttcgcagttgtgaagaaatgtcgtgagaaaagtaccggtcttcagtatgcg
gccaagttcatcaagaaaaggaggaccaagtctagccggcggggcgtgagccgggaggac
atcgagcgggaggtcagcatcctgaaggagatccggcacccaaatgtcatcaccctgcat
gaggtctatgagaacaagacagatgtcattctgatcctggagcttgttgcaggaggtgag
ctgtttgacttcctggctgagaaggaatctctgactgaagaggaggcaacggaattcctg
aagcagattctcagtggcgtttactacctgcactcacttcagatcgctcactttgacctg
aagccggaaaacataatgcttctggataggaatgtgcccaaacctcggatcaagatcatc
gactttggcttggcccataaaattgactttggaaatgaattcaaaaacatatttgggaca
ccagagtttgtggctccggagatagtcaactatgagcccctgggtcttgaggcagatatg
tggagcatcggggtaataacctatatcctcctaagtggggcctccccttttcttggagac
accaagcaagaaacattagcgaatgtatctgctgtcaactacgactttgaggaggaattc
ttccggaacaccagtacccttgccaaagatttcatcagaagactgctggtcaaggatcca
aagaagaggatgacaatccaggacagtttgcagcacccctggatcaagcctaaagacacc
caacaagcacttagtcgaaaagcctcagcagtaaacatggagaaattcaagaagtttgca
gctcggaaaaaatggaaacaatctgttcgcttgatatcactgtgccaaagattatccagg
tcatttttgtccagaagtaacatgagcgtcgccaggagcgatgatactctggatgaggaa
gactcctttgtgatgaaagccatcatccatgccatcaatgatgacaacgtacccggcctg
cagcatctcctgggctccttgtccagctatgatgtcaaccagcccaacaagcatgggaca
cctccattactgattgctgcaggctgtgggaacatccagatgttacagttactcataaaa
cgaggctcaaggattgacgtccaggataagggaggatccaatgccatctactgggcctct
cggcatggccatgtggatactttgaaatttctcaatgagaacaaatgccctttggatgtt
aaagacaagtctggagagacagctcttcacgtggcagcccgctatggccatgcagatgtg
gttcaactactgtgcagttttggctctaatcctgatttccaggacaaggaagaggaaacc
cccctgcactgtgctgcctggcatggctattactccgtggctaaagctctttgtgaagtt
ggctgcaacgtgaatatcaagaatcgggagggagagaccccattgctgactgcatctgcc
aggggctatcatgacattgtggagtgtctggctgaacatggagctgacttgaatgcttct
gacaaggatggacacatcgcccttcatcttgctgtgaggcgttgtcagatggaggtcatc
aagaccctccttggccatgggtgctttgtggatttccaggacaggcatggcaacacaccc
ctgcatgtggcctgcaaagatggaagcgcacctatcgtggtggccctctgtgaagccagc
tgcaatctggacatctcaaacaagtatggtcggactcctctccaccttgcagccaacaac
gggatcctagatgtggtccgctacctctgtttgatgggcgccaacgtggaggctctaacc
tcggatggaaagacagccgaggacctcgccaaggcagaacagcacgagcatgtggcaggg
ctcctggcaagactgcggaaggacacacaccgaggactcttcatccagcaactccgaccc
acccagaatctccagcccagaatcaagctcaaactgtttggccattcgggatcagggaaa
tccaccctggtggaatctctcaagtgtgggctgttaaggagtttcttcagaaggcgccgg
cctagactgtcctctaccaactccacccgcttcccaccgtcacccctggctgctaagccc
acagtctcagtgagcattaacaacctgtaccctggctgtgagaacgtgagcgtgaggagc
cgcagcatgatgttcgagccgggcctcaccaaagggatgctggaagtgttcgtggccccg
tctcaccacctccactgctcgactgatgatcagtccaccaaagccatcgacatccagaat
gcttatttgaacggagttggtgatttcagtgtgtgggagttctctggaaaccctgtgtac
ttctgttgctatgactactttgctgccaacgaccccacgtccatccacatcatcgttttc
agtcttgaagaaccctatgagatccagctgaaccaagtgattttctggctcagtttcctg
aagtctctggtcccagttgaagaacccatagcatttggaggcaagctgaagaaccctctc
cgagttgttctggtggccacacatgctgacatcatgaacatccctcggcctgctggaggc
gagtttggatatgacaaggatacatccttgctgaaagagatcagaaacaggttcgggaat
gaccttcatgtctcaaacaagctgtttgtcctggatgcaggagcgtctgggtctaaggac
attaaggttcttcggaatcacctgcaagaaatacggagccagattgtctcggggtgtccg
cccatgactcacctgtgcgagaagatcatctccacgctgccctcctggcggaagctcaac
gggccaaaccagctgatgtcgctgcagcagtttgtgtatgacgtgcaggaccaactgaac
cccctggcctctgaggatgacctcaggcacattgcacaacagctacacagcacgggggag
atcaacatcatgcagagtgagacagtgcaggacgtgttactgctggatcctcgatggctc
tgcaccaacgtcctggggaagctgctgtctgtggagacgccccgagccctgcaccattac
cggggccgctacaccatggaagacatccagcgtctggtcccagacagtgacgtggaggag
ctgctgcagatactggatgccatggacatctgcgcccgagacctgagtagtgggactatg
gtggatatccctgctctgatcaaaacagacagcctgcagcgctcctgggcagatgaggag
gatgaggtgatggtgtacggtggggtgcgcatcgtccctgtagagcacctcacccccttc
ccctgtggcatctttcacaaagttcaggtcaacctgtgccggtggatccaccagcaaagc
gccgagggtgatgcggacatccgtctgtgggtgagcggctgcaggatcgccaaccgcggg
gctgagttgctggtgctgctggtcaatcacggtcagggcatcgaggtacaggtgcgtggc
ctggagacggagaagattaagtgctgcctgctgctggactcggtgtgcagcaccatcgag
accgtcatggccaccaccttgccggggttgttgacggtgaagcactacctgagcccccag
cagctaagggagcaccacgaaccggtcatggtctatcagccccgggacttcttccgtgcg
cagaccctgaaagagagttcccttaccaacaccatgggagggtacaaggagagcttcagc
agcatcacgtgctttgggtgtcatgacgtctactcacaggccagtcttggtatggatatt
catgcgtcagacctgagtctcctgacccggaggaaactgagtcgcctgcttgacccacct
gaccccatggggaaggactggtgccttctggccatgaacttgggcctcccagacatggtg
gccaaacacaatgtcaacaacagggcttctagggatttcctccctagcccagtgcatgcc
ttgctacaggaatggacctcctaccctgagagcacggtgggcatccttatatccaaactt
cgggagctggggcgccgggatgctgcggactttttactgaaggcctcctctgtcttcaag
atcaaccttgatggcaatggccaggaggcctatgcctcaagctgtaacagtggcacgtcc
tacaattccattagctcagtggtgtcccggagagactcccatgcttggaccccactgtat
gatttataa

DBGET integrated database retrieval system