KEGG   Mus caroli (Ryukyu mouse): 110301725
Entry
110301725         CDS       T05910                                 

Gene name
Tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04068  FoxO signaling pathway
mcal04144  Endocytosis
mcal04218  Cellular senescence
mcal04350  TGF-beta signaling pathway
mcal04380  Osteoclast differentiation
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04659  Th17 cell differentiation
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05142  Chagas disease
mcal05161  Hepatitis B
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05220  Chronic myeloid leukemia
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110301725 (Tgfbr2)
   04350 TGF-beta signaling pathway
    110301725 (Tgfbr2)
   04390 Hippo signaling pathway
    110301725 (Tgfbr2)
   04068 FoxO signaling pathway
    110301725 (Tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110301725 (Tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110301725 (Tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    110301725 (Tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110301725 (Tgfbr2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110301725 (Tgfbr2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110301725 (Tgfbr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110301725 (Tgfbr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301725 (Tgfbr2)
   05202 Transcriptional misregulation in cancer
    110301725 (Tgfbr2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110301725 (Tgfbr2)
   05212 Pancreatic cancer
    110301725 (Tgfbr2)
   05225 Hepatocellular carcinoma
    110301725 (Tgfbr2)
   05226 Gastric cancer
    110301725 (Tgfbr2)
   05220 Chronic myeloid leukemia
    110301725 (Tgfbr2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110301725 (Tgfbr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110301725 (Tgfbr2)
   05161 Hepatitis B
    110301725 (Tgfbr2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110301725 (Tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110301725 (Tgfbr2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110301725 (Tgfbr2)
Protein kinases [BR:mcal01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110301725 (Tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 110301725
NCBI-ProteinID: XP_021028002
Ensembl: MGP_CAROLIEiJ_G0032782
LinkDB
Position
9
AA seq 592 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSD
VMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNI
TLETVCHDPKLTYHGFTLEDAASPKCLMKEKKRAGETFFMCACNMEECNDHIIFSEEYTT
SSPDLLLVIIQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKLSPSWESSKPRKLMDFSDN
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYSSWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDSVLRDRGRPEIPSFWLNHQGIQIVCE
TLTECWDHDPEARLTAQCVAERFSELEHPERLSGRSCSQEKIPEDGSLNTTK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcatatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggatgtggaaatggaagcccagaaagat
gcatccatccacctaagctgtaataggaccatccatccactgaaacattttaacagtgat
gtcatggccagcgacaatggcggtgcagtcaagcttccacagctgtgtaagttttgcgat
gtgagattgtccacttgcgacaaccagaagtcctgcatgagcaactgcagcatcacggcc
atctgtgagaagccgcatgaagtctgcgtggccgtgtggaggaagaacgacaagaacatt
actctggagacggtttgccacgaccccaagctcacctaccacggcttcactctggaagat
gccgcttctcccaagtgcctcatgaaggaaaagaaaagggcgggcgagactttcttcatg
tgcgcctgtaacatggaggagtgcaacgatcacatcatcttctcggaagaatacaccacc
agcagtcccgacctgttgttggtcattatccaagtgacgggcgtcagcctcctgcctccg
ctggggattgccatagctgtcatcatcatcttctactgctaccgtgtccaccggcagcag
aagttgagcccgtcctgggagagcagcaagccccggaagctcatggatttcagtgacaac
tgcgccatcatcctggaggacgaccgctccgacatcagctccacgtgcgccaacaacatc
aaccacaacacggagctgctacccatcgagctggacacgctggtggggaagggccgcttc
gccgaggtctacaaggccaagctgaagcagaacacctcagagcagtttgagaccgtggct
gtcaagatcttcccctacgaggagtactcctcatggaaaacggagaaggacatcttctcc
gatatcaacctgaagcatgagaacatcctgcagttcttgacggccgaggagcggaagaca
gagctgggcaagcagtactggctgatcacggcattccatgcaaagggcaacctgcaggag
tacctcacgaggcatgtcatcagctgggaggacctgaggaaactgggcagctccctggcc
cggggcatcgctcatctccacagtgaccacactccttgtgggaggcccaagatgcccatt
gttcacagggacctcaagagctctaacatcctagtgaagaacgacttgacctgttgcctg
tgtgactttgggctgtccttgcgcctggaccctactctgtctgtggatgacctggccaac
agcgggcaggtggggacggcaagatacatggccccggaagttctagaatccaggatgaat
ctggaaaacgtggagtcgttcaagcagacggatgtctactccatggctctggtactctgg
gaaatgacgtcccgctgcaatgctgtgggagaagtgaaagattacgagcccccatttggt
tccaaggtgcgggagcacccctgtgtggagagcatgaaagatagcgtgctgagagaccga
gggcggccggaaatccccagcttctggctcaaccaccagggcatccagatcgtgtgtgag
actttgaccgagtgctgggaccatgaccccgaggcccgtctcacagcccagtgtgtggcg
gagcgcttcagtgagctggagcacccggagagactctctgggaggagctgctcccaggag
aagattccagaagacggctcgctgaacactaccaaatag

DBGET integrated database retrieval system