KEGG   Mus caroli (Ryukyu mouse): 110301829
Entry
110301829         CDS       T05910                                 

Gene name
Ets1
Definition
(RefSeq) protein C-ets-1
  KO
K02678  C-ets-1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal04218  Cellular senescence
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110301829 (Ets1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110301829 (Ets1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301829 (Ets1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110301829 (Ets1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110301829 (Ets1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110301829 (Ets1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    110301829 (Ets1)
SSDB
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Other DBs
NCBI-GeneID: 110301829
NCBI-ProteinID: XP_021028157
Ensembl: MGP_CAROLIEiJ_G0031946
UniProt: A0A6P5QD82
LinkDB
Position
9
AA seq 440 aa
MKAAVDLKPTLTIIKTEKVDLELYPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGR
ASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDAD
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgaaggcggccgtcgatctcaagccgactctcaccatcatcaagacagaaaaagtggat
ctcgagctttacccttccccggacatggaatgtgcagatgtcccgctgttaactccgagc
agcaaagagatgatgtcccaagcattgaaagctactttcagtggtttcacaaaagaacag
caacgactgggaatccccaaagacccccggcagtggacagaaacccatgtccgggattgg
gtgatgtgggctgtgaatgagttcagcctgaagggtgtggacttccagaagttctgtatg
agtggagcagcactgtgtgccctgggtaaagaatgcttcctcgagctggctccagacttt
gttggggatatcctgtgggagcatctagagatcctgcagaaagaggatgtgaaaccatat
caggttaatggagccaaccctacctacccagaatcctgttacacctcggattacttcatc
agctatggtatcgagcatgctcagtgtgttcctccctcagagttctcagagcccagcttc
atcacagagtcctatcagacgctgcatcccatcagctcggaagaactcctgtccctcaag
tatgagaacgactacccttctgtcattctccaggaccctctccagacagacaccttgcag
acagactactttgccatcaagcaagaggtgttaactccagacaacatgtgcctggggaga
gccagtcgtggtaaactcgggggccaggactcttttgagagcgtagagagctacgatagt
tgtgaccgcctcacccagtcctggagcagccagtcatccttcaacagcctgcagcgggtc
ccctcctatgacagcttcgactacgaggattatcccgctgccctgcccaaccacaagccc
aagggcaccttcaaggactatgtgcgtgaccgtgctgacctcaacaaggacaagcctgtc
attcctgctgctgccctggctggctacacaggaagtgggccgatccagctgtggcagttt
cttctggaattactcactgataagtcttgtcagtcttttatcagctggacaggagatggc
tgggaattcaagctttctgacccagatgaggtggccaggagatggggaaagaggaaaaac
aaacctaagatgaattatgagaaactgagccgtggccttcgctactattatgacaaaaat
atcatccacaagacagcgggtaaacgctacgtataccgctttgtgtgcgacctgcagagc
ctgctgggatacacccctgaggagctgcacgccatgctggacgtaaagccggatgctgac
tag

DBGET integrated database retrieval system