KEGG   Mus caroli (Ryukyu mouse): 110301878
Entry
110301878         CDS       T05910                                 

Gene name
Mlh1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal03430  Mismatch repair
mcal03460  Fanconi anemia pathway
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    110301878 (Mlh1)
   03460 Fanconi anemia pathway
    110301878 (Mlh1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301878 (Mlh1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110301878 (Mlh1)
   05226 Gastric cancer
    110301878 (Mlh1)
   05213 Endometrial cancer
    110301878 (Mlh1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110301878 (Mlh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110301878 (Mlh1)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     110301878 (Mlh1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c Hfx_Cass5
Other DBs
NCBI-GeneID: 110301878
NCBI-ProteinID: XP_021028230
Ensembl: MGP_CAROLIEiJ_G0032755
UniProt: A0A6P5QDF1
LinkDB
Position
9
AA seq 760 aa
MAFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTNIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQTFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLQAPPKPCAGNQGTLITVEDLFYNIITRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVSDIRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESAALRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILQRVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEAV
RPTTGVASSSTSGSGDKVYAYQMVRTDSRDQKLDAFLQPVSSLGPSQPQDPVPVRGARTE
GSPERATRKDEEMLALPAPAEAAAESENLERESLMETSDAAQKAAPTSSPGSSRKRHRED
SDVEMVENASGKEMTAACYPRRRIINLTSVLSLQEEISERCHETLREMLRNHSFVGCVNP
QWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEAAPLFDLAMLALDSPESG
WTEDDGPKEGLAEYIVEFLKKKAEMLADYFSVEIDEEGNLIGLPLLIDSYVPPLEGLPIF
ILRLATEVNWDEEKECFESLSKECAMFYSIRKQYILEESTLSGQQSDMPGSTSKPWKWTV
EHIIYKAFRSHLLPPKHFTEDGNVLQLANLPDLYKVFERC
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcgtttgttgccggagttattcggcgtctggacgagacggtagtgaaccgcatagcg
gcgggggaagtcattcagcggccggccaatgctatcaaagagatgatcgaaaactgttta
gatgcaaaatctacaaatattcaagtggttgttaaagaaggaggcctgaagctaattcag
atccaagacaatggcactggaatcaggaaggaagatctggatattgtgtgtgaaaggttc
actacgagtaaactgcagacttttgaggatttagccagtatttctacctacggctttcgt
ggtgaggcgttggcaagcataagccatgtggcccatgtcactattacaaccaaaacagct
gatggaaaatgtgcatacagagcaagttactcagatggaaagctgcaagcccctcctaaa
ccctgtgcaggcaatcagggtaccctgatcacggtggaagaccttttttacaacataatc
acaaggaggaaagctttaaaaaatccaagtgaagagtacggaaaaattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagttaaaaaacaaggtgagaca
gtatctgacatcagaacactgcccaatgccacaacggtggacaacattcgctccatcttt
ggaaatgcggttagtcgagaactgatagaagttgggtgtgaggataaaaccctagctttc
aaaatgaatggctatatatcgaatgcaaactactcagtgaagaagtgcattttcctactc
ttcatcaaccaccgtctggtagaatcagctgccttgagaaaagccatagaaactgtatat
gcagcatatttgcccaaaaacacacacccattcctgtacctcagtttggaaatcagccct
cagaacgtggacgtcaatgtacaccccaccaagcacgaagttcactttctgcacgaggag
agcattctgcagcgtgtgcagcagcacattgagagcaagctgctgggctccaattcctcc
aggatgtatttcacccagaccttgcttccaggacttgctgggccctctggggaggcagtt
agacccacgacaggggtggcttcctcgtccactagtggaagtggcgacaaggtctacgct
taccagatggtccgtacggactcccgggatcagaagcttgacgcctttctgcagcctgta
agcagccttgggcccagccagccccaggaccctgtccctgtccgaggggccaggacagaa
ggctctcctgaacgggccacgcggaaggacgaggagatgcttgctctcccagcccccgct
gaagcagctgctgagagcgagaacttggagagggaatcactaatggagacttcagacgca
gcccagaaagcggcacccacttccagtccaggcagctccagaaagagacatcgggaggac
tctgatgtggaaatggtggaaaatgcttccgggaaggaaatgacggctgcttgctacccc
cggaggaggatcattaatctcaccagtgtcttgagtctccaggaagagattagtgagcgg
tgccatgagactctccgggagatgctccgtaaccattcctttgtgggctgtgtgaatcct
cagtgggccttggcgcagcaccagaccaagctgtacctcctcaacactaccaagctcagt
gaagagctgttctaccagatactcatttatgattttgccaactttggtgttctgaggtta
tcggaagcagcaccactcttcgacctcgccatgctggccttagacagccctgaaagtggc
tggacagaggatgacggcccgaaggaagggcttgcagagtacattgttgaatttctgaag
aagaaggcggagatgcttgcagactatttctctgtggaaatcgatgaggaagggaacctg
attggattacctcttctgattgacagctatgtgccacctttggagggactgcctatcttc
attcttcgactggccactgaggtgaattgggatgaagaaaaggagtgttttgaaagtctc
agtaaagaatgtgctatgttttactccattcggaagcagtatatactggaggagtcgacc
ctctcaggccagcagagtgacatgcctggctccacgtcaaagccctggaagtggactgtg
gagcacattatctataaagccttccgctcacacctcctacctccaaagcatttcacagaa
gatggcaatgtcctgcagcttgccaacctgccagatctatacaaagtctttgagcggtgt
taa

DBGET integrated database retrieval system