KEGG   Mus caroli (Ryukyu mouse): 110302131
Entry
110302131         CDS       T05910                                 

Gene name
Il1r2
Definition
(RefSeq) interleukin-1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04640  Hematopoietic cell lineage
mcal05146  Amoebiasis
mcal05166  Human T-cell leukemia virus 1 infection
mcal05202  Transcriptional misregulation in cancer
mcal05215  Prostate cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110302131 (Il1r2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110302131 (Il1r2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110302131 (Il1r2)
  09162 Cancer: specific types
   05215 Prostate cancer
    110302131 (Il1r2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110302131 (Il1r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110302131 (Il1r2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110302131 (Il1r2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcal04050]
    110302131 (Il1r2)
   04090 CD molecules [BR:mcal04090]
    110302131 (Il1r2)
Cytokine receptors [BR:mcal04050]
 Interleukin receptor families
  IL1 receptor family
   110302131 (Il1r2)
CD molecules [BR:mcal04090]
 Proteins
  110302131 (Il1r2)
SSDB
Motif
Pfam: ig Ig_3 I-set V-set Ig_2 Ig_6 Ig_5 Izumo-Ig Stevor
Other DBs
NCBI-GeneID: 110302131
NCBI-ProteinID: XP_021028583
Ensembl: MGP_CAROLIEiJ_G0014077
UniProt: A0A6P5QEB7
LinkDB
Position
1
AA seq 410 aa
MFLLLVLVTGVSAFTTPTVVHTGKVSESPVTSEKPTVHGDNCQFRGREFKSELRLEGEPV
VLRCPLAPHSDISSSSHSLLTWSKLDSSQLIPRDEPRMWVKGNILWILPAVQQDSGTYIC
TFRNASHCEQMSVELKVFKNTEASLPHVSYLQISALSTTGLLVCPDLKEFISSNADGKIQ
WYKGSMLLDKGSKEFLSAGDPTRLLISNTSMDDAGYYRCVMTFTYNGQEYNITRNIELRV
KGTTTEPIPVIISPLETIPASLGSRLIVPCKVFLGTGTSSNTIVWWLANSTFISAAYPRG
RVTEGLHHQYSENDENYVEVSLIFDPVTREDLNTDFKCVASNPRSSQSLHTTVKEVSSTF
SWSIALAPLSLIILVVGAIWMRRRCKRRAGKTYGLTKLRTDNQDFPSSPN
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgttcctcttgcttgtgttagtaactggggtttctgctttcaccactccaacagtggtg
cacacaggaaaggtttctgaatcccccgttacatcggagaagcccacagtccatggagac
aactgccagtttcgtggcagagagttcaaatctgaattgaggctggaaggtgaacctgtg
gttctgaggtgccccttggcaccacactccgacatctccagcagttcccacagccttctg
acctggagtaaattggactcttctcagctgatcccaagagatgaaccaaggatgtgggtg
aagggtaacatactctggattctgccagcagtgcagcaagactctggtacctacatttgc
acattcagaaacgcatcccactgtgagcaaatgtcggtggaactcaaggtctttaagaat
actgaagcatctctgcctcatgtctcctacttgcaaatctcagctctctccaccaccggg
ttactagtgtgccctgacctgaaagaattcatctccagcaacgctgatggaaagatacag
tggtataagggctccatgctcttggataaaggcagtaaggaatttctgagtgcaggagac
cccacacgcctattgatatccaacacgtccatggacgacgcaggctattacagatgtgtt
atgacatttacctacaatggccaggaatacaacatcactaggaatattgaactccgggtc
aaaggaacaaccacggaacccatccctgtgatcatttctcccctggagacaataccagca
tcactggggtcaagactgatagtcccgtgcaaagtgtttctgggaactggtacatcttcc
aacaccattgtgtggtggttggctaacagcacatttatctcagctgcttacccaagaggc
cgtgtgaccgaggggctacaccaccagtactcagagaatgatgaaaactatgtggaagtg
tcgctgatttttgatccagtcacaagggaggatctgaatacagattttaaatgtgttgcc
tcgaatccacggagttctcagtcactccataccacagtcaaagaagtctcttccacgttc
tcctggagcattgcgctggcacctctgtctctgatcatcttggttgtgggggcaatatgg
atgcgcagacggtgtaaacgcagggctggaaagacatatggactgaccaagctacggact
gacaaccaggacttcccttccagcccaaactaa

DBGET integrated database retrieval system