Mus caroli (Ryukyu mouse): 110302433 Help Entry 110302433         CDS       T05910                                  Gene name Bcl2 Definition (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal01521   EGFR tyrosine kinase inhibitor resistance mcal01522   Endocrine resistance mcal01524   Platinum drug resistance mcal04064   NF-kappa B signaling pathway mcal04066   HIF-1 signaling pathway mcal04071   Sphingolipid signaling pathway mcal04115   p53 signaling pathway mcal04140   Autophagy - animal mcal04141   Protein processing in endoplasmic reticulum mcal04151   PI3K-Akt signaling pathway mcal04210   Apoptosis mcal04215   Apoptosis - multiple species mcal04217   Necroptosis mcal04261   Adrenergic signaling in cardiomyocytes mcal04340   Hedgehog signaling pathway mcal04510   Focal adhesion mcal04621   NOD-like receptor signaling pathway mcal04630   JAK-STAT signaling pathway mcal04722   Neurotrophin signaling pathway mcal04725   Cholinergic synapse mcal04915   Estrogen signaling pathway mcal04928   Parathyroid hormone synthesis, secretion and action mcal04933   AGE-RAGE signaling pathway in diabetic complications mcal05014   Amyotrophic lateral sclerosis mcal05022   Pathways of neurodegeneration - multiple diseases mcal05132   Salmonella infection mcal05145   Toxoplasmosis mcal05152   Tuberculosis mcal05161   Hepatitis B mcal05162   Measles mcal05168   Herpes simplex virus 1 infection mcal05169   Epstein-Barr virus infection mcal05170   Human immunodeficiency virus 1 infection mcal05200   Pathways in cancer mcal05206   MicroRNAs in cancer mcal05210   Colorectal cancer mcal05215   Prostate cancer mcal05222   Small cell lung cancer mcal05226   Gastric cancer mcal05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110302433 (Bcl2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     110302433 (Bcl2)    04630 JAK-STAT signaling pathway     110302433 (Bcl2)    04064 NF-kappa B signaling pathway     110302433 (Bcl2)    04066 HIF-1 signaling pathway     110302433 (Bcl2)    04071 Sphingolipid signaling pathway     110302433 (Bcl2)    04151 PI3K-Akt signaling pathway     110302433 (Bcl2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110302433 (Bcl2)   09143 Cell growth and death    04210 Apoptosis     110302433 (Bcl2)    04215 Apoptosis - multiple species     110302433 (Bcl2)    04217 Necroptosis     110302433 (Bcl2)    04115 p53 signaling pathway     110302433 (Bcl2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     110302433 (Bcl2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110302433 (Bcl2)   09152 Endocrine system    04915 Estrogen signaling pathway     110302433 (Bcl2)    04928 Parathyroid hormone synthesis, secretion and action     110302433 (Bcl2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     110302433 (Bcl2)   09156 Nervous system    04725 Cholinergic synapse     110302433 (Bcl2)    04722 Neurotrophin signaling pathway     110302433 (Bcl2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110302433 (Bcl2)    05206 MicroRNAs in cancer     110302433 (Bcl2)   09162 Cancer: specific types    05210 Colorectal cancer     110302433 (Bcl2)    05226 Gastric cancer     110302433 (Bcl2)    05215 Prostate cancer     110302433 (Bcl2)    05222 Small cell lung cancer     110302433 (Bcl2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110302433 (Bcl2)    05022 Pathways of neurodegeneration - multiple diseases     110302433 (Bcl2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110302433 (Bcl2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110302433 (Bcl2)   09171 Infectious disease: bacterial    05132 Salmonella infection     110302433 (Bcl2)    05152 Tuberculosis     110302433 (Bcl2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110302433 (Bcl2)    05161 Hepatitis B     110302433 (Bcl2)    05162 Measles     110302433 (Bcl2)    05168 Herpes simplex virus 1 infection     110302433 (Bcl2)    05169 Epstein-Barr virus infection     110302433 (Bcl2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110302433 (Bcl2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110302433 (Bcl2)    01524 Platinum drug resistance     110302433 (Bcl2)    01522 Endocrine resistance     110302433 (Bcl2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcal01009]     110302433 (Bcl2) Protein phosphatases and associated proteins [BR:mcal01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      110302433 (Bcl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  110302433 NCBI-ProteinID:  XP_021028902 Ensembl:  MGP_CAROLIEiJ_G0014488 UniProt:  A0A6P5QF10 LinkDB All DBs Position 1 AA seq 236 aa AA seqDB search MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA VHRDMAARTSPLRPLVTTAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtacatacat tataagctgtcacagaggggctatgagtgggatgctggagatgcggacgcggcgcccctg ggggctgcccccacccctggcatcttctccttccagcctgagagcaacccaatgcccgct gtgcaccgggacatggctgccaggacgtctcctctcaggcccctcgttaccactgctggg cctgcgctcagccctgtgccacctgtggtccacctgaccctccgccgggctggggatgac ttctctcgccgctaccgtcgtgacttcgcagagatgtccagtcagctgcacctgacgccc ttcaccgcgaggggacgctttgccacggtggtggaggaactcttcagggatggggtgaac tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac agggagatgtcacccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg catctgcacacctggatccaggataacggaggctgggatgcctttgtggaactatatggc cccagcatgcgacctctgtttgatttctcctggctgtctctgaagacactgctcagcctg gccctggttggggcctgcatcactctgggtgcatacctgggccacaagtga

DBGET integrated database retrieval system