KEGG   Mus caroli (Ryukyu mouse): 110302433
Entry
110302433         CDS       T05910                                 

Gene name
Bcl2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04064  NF-kappa B signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04115  p53 signaling pathway
mcal04140  Autophagy - animal
mcal04141  Protein processing in endoplasmic reticulum
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04340  Hedgehog signaling pathway
mcal04510  Focal adhesion
mcal04621  NOD-like receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04915  Estrogen signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05014  Amyotrophic lateral sclerosis
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05162  Measles
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05215  Prostate cancer
mcal05222  Small cell lung cancer
mcal05226  Gastric cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110302433 (Bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110302433 (Bcl2)
   04630 JAK-STAT signaling pathway
    110302433 (Bcl2)
   04064 NF-kappa B signaling pathway
    110302433 (Bcl2)
   04066 HIF-1 signaling pathway
    110302433 (Bcl2)
   04071 Sphingolipid signaling pathway
    110302433 (Bcl2)
   04151 PI3K-Akt signaling pathway
    110302433 (Bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110302433 (Bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    110302433 (Bcl2)
   04215 Apoptosis - multiple species
    110302433 (Bcl2)
   04217 Necroptosis
    110302433 (Bcl2)
   04115 p53 signaling pathway
    110302433 (Bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110302433 (Bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110302433 (Bcl2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110302433 (Bcl2)
   04928 Parathyroid hormone synthesis, secretion and action
    110302433 (Bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110302433 (Bcl2)
  09156 Nervous system
   04725 Cholinergic synapse
    110302433 (Bcl2)
   04722 Neurotrophin signaling pathway
    110302433 (Bcl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302433 (Bcl2)
   05206 MicroRNAs in cancer
    110302433 (Bcl2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110302433 (Bcl2)
   05226 Gastric cancer
    110302433 (Bcl2)
   05215 Prostate cancer
    110302433 (Bcl2)
   05222 Small cell lung cancer
    110302433 (Bcl2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110302433 (Bcl2)
   05022 Pathways of neurodegeneration - multiple diseases
    110302433 (Bcl2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110302433 (Bcl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110302433 (Bcl2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110302433 (Bcl2)
   05152 Tuberculosis
    110302433 (Bcl2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110302433 (Bcl2)
   05161 Hepatitis B
    110302433 (Bcl2)
   05162 Measles
    110302433 (Bcl2)
   05168 Herpes simplex virus 1 infection
    110302433 (Bcl2)
   05169 Epstein-Barr virus infection
    110302433 (Bcl2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110302433 (Bcl2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110302433 (Bcl2)
   01524 Platinum drug resistance
    110302433 (Bcl2)
   01522 Endocrine resistance
    110302433 (Bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110302433 (Bcl2)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110302433 (Bcl2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 110302433
NCBI-ProteinID: XP_021028902
Ensembl: MGP_CAROLIEiJ_G0014488
UniProt: A0A6P5QF10
LinkDB
Position
1
AA seq 236 aa
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA
VHRDMAARTSPLRPLVTTAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 711 nt   +upstreamnt  +downstreamnt
atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtacatacat
tataagctgtcacagaggggctatgagtgggatgctggagatgcggacgcggcgcccctg
ggggctgcccccacccctggcatcttctccttccagcctgagagcaacccaatgcccgct
gtgcaccgggacatggctgccaggacgtctcctctcaggcccctcgttaccactgctggg
cctgcgctcagccctgtgccacctgtggtccacctgaccctccgccgggctggggatgac
ttctctcgccgctaccgtcgtgacttcgcagagatgtccagtcagctgcacctgacgccc
ttcaccgcgaggggacgctttgccacggtggtggaggaactcttcagggatggggtgaac
tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac
agggagatgtcacccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg
catctgcacacctggatccaggataacggaggctgggatgcctttgtggaactatatggc
cccagcatgcgacctctgtttgatttctcctggctgtctctgaagacactgctcagcctg
gccctggttggggcctgcatcactctgggtgcatacctgggccacaagtga

DBGET integrated database retrieval system