KEGG   Mus caroli (Ryukyu mouse): 110302801
Entry
110302801         CDS       T05910                                 

Gene name
Apaf1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal05010  Alzheimer disease
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05134  Legionellosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05164  Influenza A
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110302801 (Apaf1)
   04215 Apoptosis - multiple species
    110302801 (Apaf1)
   04115 p53 signaling pathway
    110302801 (Apaf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302801 (Apaf1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110302801 (Apaf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110302801 (Apaf1)
   05012 Parkinson disease
    110302801 (Apaf1)
   05014 Amyotrophic lateral sclerosis
    110302801 (Apaf1)
   05016 Huntington disease
    110302801 (Apaf1)
   05020 Prion disease
    110302801 (Apaf1)
   05022 Pathways of neurodegeneration - multiple diseases
    110302801 (Apaf1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110302801 (Apaf1)
   05152 Tuberculosis
    110302801 (Apaf1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110302801 (Apaf1)
   05160 Hepatitis C
    110302801 (Apaf1)
   05164 Influenza A
    110302801 (Apaf1)
   05162 Measles
    110302801 (Apaf1)
   05168 Herpes simplex virus 1 infection
    110302801 (Apaf1)
   05169 Epstein-Barr virus infection
    110302801 (Apaf1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110302801 (Apaf1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 Nup160 AAA_16 AAA_22
Other DBs
NCBI-GeneID: 110302801
NCBI-ProteinID: XP_021029198
Ensembl: MGP_CAROLIEiJ_G0015723
UniProt: A0A6P5QFQ7
LinkDB
Position
10
AA seq 1248 aa
MDAKARNCLLQHREALEKDIKTSYIMDHMISNGVLSVIEEEKVKSQATQYQRAAALIKMI
LNKDNCAYISFYNALLHEGYKDLAALLQSGLPLVSSSSGKDTGGITSFVRTVLCEGGVPQ
RPVIFVTRKKLVHAIQQKLWKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSLLEGCFSGG
VHWVSIGKQDKSGLLMKLQNLCTRLEQAESFSQRLPLNIEEAKDRLRVLMLRKHPRSLLI
LDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVTGPKHVVPVESGLGREKGLEILSLFVNM
KKEDLPAEAHSIIKECKGSPLVVSLIGALLRDFPNRWAYYLRQLQNKQFKRIRKSSSYDY
EALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCVLWDLETEEVEDILQEFVNK
SLLFCNRNGKSFCYYLHDLQVDFLTEKNRSQLQDLHRKMVTQFQRYYQPHTLSPVQEDCM
YWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVAYRHILDEKDCAVC
ENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYRQAKLKAKQEVDTGRLYLEWINKT
TIKNLSRLVVRPHTDAVYHACFSQDGQRIASCGADKTLQVFKAETGEKLLDIKAHEDEVL
CCAFSSDDSYIATCSVDKKVKIWDSATGKLMHTYDEHSEQVNCCHFTNKSNHLLLATGSN
DFFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDELLASCSADGTLRLWDVRSANERKSI
NVKRFFLSSEDPAEDVEVIVKCCSWSADGDKIIVAAKNKVLLFDIHTSDLLAEIHTGHHS
TIQYCDFSPYDHLAVIALSQYCVELWNIDSRLKVADCRGHLSWVHGVMFSPDGSSFLTAS
DDQTIRVWETKKVCKNSAIVLKQEIDVVFQENETMVLAVDNIRGLQLIAGKTGQIDYLPE
AQVSCCCLSPHLEYVAFGDEDGAIKIIELPNNRVFSSGTGHKKAVRHIQFTADGKTLISS
SEDSVIQVWNWQTGDYVFLQAHQETVKDFRLLQDSRLLSWSFDGTVKVWNIITGRIERDF
TCHQGTVLSCAISSDATKFSSTSADKTAKIWSFDLLSPLHELKGHNGCVRCSAFSLDGIL
LATGDDNGEIRIWNVSDGQLLHSCPPISVEEGTATHGGWVTDVCFSPDSKTLVSAGGYLK
WWNFATGDSSQIFYTNGTNLKKIHVSPDFRTYVTVDNLGILYILQVLE
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggatgcaaaggcccgcaattgtttgcttcaacatagagaagctttggaaaaggacatc
aaaacatcctacatcatggatcacatgatcagtaatggcgtcttgtcagtgatagaggag
gagaaggtcaaaagtcaggccactcaatatcaacgagcagccgctttaattaaaatgata
cttaataaagacaactgtgcctacatttcattctacaacgctctgctacatgagggctat
aaggaccttgctgcacttctgcagagtggccttcctcttgtgtcatcttccagtggcaag
gatacaggtggaataacttcatttgtaaggacagtgctgtgtgaaggtggagtaccccag
aggccggttattttcgttactagaaagaagctggtccatgcgattcagcagaagctctgg
aaactgaatggagaaccagggtgggtcaccatctatgggatggcaggctgtggcaagtct
gtgttagctgcggaagccgttcgagatcactccctcttagaaggttgcttttcagggggt
gtacactgggtttccattggaaaacaagacaaatctgggcttctcatgaaactgcagaat
ctgtgcacgcggttggaacaagcagagagtttctctcagaggcttccacttaatattgag
gaggccaaagaccgtctccgtgttctgatgctgcgcaaacacccaaggtctctgttgatc
ttggatgacgtttgggatccttgggtgttaaaagcttttgacaatcagtgtcagattctt
ctcacaaccagagataagagtgttacagattcagtaacgggtcctaagcatgttgtccct
gtggagagtggtctagggagagagaaaggacttgagatcttgtcactttttgttaacatg
aagaaagaagatctgccagcggaggctcacagtattataaaggaatgcaaaggttctcct
cttgtagtgtctttaattggtgcgcttttacgtgattttcccaatcgctgggcatactac
ctcagacagcttcagaataagcagtttaagagaataaggaagtcttcctcttatgattat
gaggctctggatgaagccatgtcgataagtgttgaaatgctcagagaagacatcaaagac
tattacacagacctttccatccttcagaaggacgtcaaggtgcctacaaaggtgttgtgc
gttctctgggacttggaaacggaagaagttgaagacatcctgcaggagttcgttaataag
tctctcttattctgtaatcggaatggaaagtcattttgttattatttacatgatcttcaa
gtagattttcttacagagaagaatcgcagtcagcttcaggatctgcacaggaagatggtc
actcagtttcagaggtattaccagccacacacgctgtctccagtccaggaggactgcatg
tattggtacaacttcctagcttatcacatggccagtgccaatatgcacaaagaattgtgt
gctttaatgttttccctggactggattaaagcaaaaacagaacttgtcggccctgcccat
ctgattcatgagttcgtggcatataggcatatattggatgaaaaggattgtgcagtctgt
gagaattttcaagagtttttatctttaaatggacacctccttggacgacagccatttcct
aatattgtacagctgggcctctgtgaaccagaaacttccgaagtttatcgacaagcaaag
ctgaaggccaagcaggaggtggatactgggcgcctttacctggaatggataaacaaaaca
actatcaagaatctgtcccgcttagtcgtccgcccccacacagatgctgtttaccacgcg
tgtttttctcaggatggtcagagaatagcttcttgtggagctgataaaaccttacaggtg
ttcaaagccgagacaggagagaaacttcttgacatcaaagctcatgaagatgaggtgctc
tgctgcgcgttctcctcagacgacagttacatagcgacctgctcagtggataagaaggtt
aagatttgggattctgcgactgggaagctcatgcacacttacgatgagcactcagagcaa
gtcaattgctgccatttcaccaacaagagtaaccaccttctcttggccaccgggtcaaat
gatttcttcctcaagctctgggatttgaatcaaaaagaatgtcgaaataccatgtttggt
cacacgaactcagtcaaccactgcaggttctcaccagacgatgagctcttggctagctgc
tcagctgacgggactttaaggctttgggatgtgagatcagcaaacgagaggaaaagcatt
aatgtgaagcgcttcttcctgagttcagaagaccctgcagaggatgtggaggtgatcgtg
aagtgctgttcctggtctgcagatggtgacaaaataatagtggcagccaaaaacaaagtc
ctcctttttgatattcatactagtgacctattggcagagatccacacaggccatcacagc
accatccagtactgtgacttctccccctatgaccatttggctgtgattgccctgtctcag
tactgtgtggagttgtggaacatagactcccgcctaaaggtggccgactgcagaggacat
ttgagttgggttcacggtgtgatgttttctcccgatggctcgtcatttttgacagcttct
gatgaccaaacaataagggtctgggagacaaaaaaggtatgcaagaactctgccatcgtg
ctaaagcaggaaatagacgtcgtgtttcaagagaacgaaacgatggtccttgcagttgac
aacataagaggcctgcaactcattgctggaaaaacaggccagattgattacctgcctgaa
gcccaagtgagttgctgctgcctcagtccacaccttgagtacgtggcattcggagatgaa
gatggagccattaagattatagaacttccaaacaacagagttttcagttctgggactggg
cacaagaaagctgtccggcacatccagttcacagctgatgggaagacactgatttcaagt
tctgaagattctgtgattcaggtatggaattggcagacaggggactatgtatttttgcaa
gcccaccaggaaacagtaaaggacttcaggctcctccaagattcaagattgctttcttgg
tcgtttgatggaacggtgaaggtgtggaatatcattaccggaagaatagaaagagacttt
acttgtcatcagggcacagtgctttcctgtgctatctcttctgatgcgaccaagttttca
tctacctctgctgataagactgccaagatctggagttttgacctcctttcccctcttcat
gagctgaagggccataatggctgtgtccgctgctctgccttctcgctggatggcatcctg
ttggcaactggagatgacaatggagaaatccggatatggaatgtctcagatggccagctt
cttcattcgtgtcctccgatctcggtagaggaaggaactgctacccacggtggctgggta
actgatgtgtgcttctctcccgacagtaaaacgcttgtctctgctggaggatatctcaag
tggtggaattttgccactggggactcctcacagatcttctacacaaatggaacaaacctc
aagaaaatacacgtgtcccctgacttcagaacctacgtgactgtcgataatctcggtatt
ttatatattttacaggttttagagtaa

DBGET integrated database retrieval system