KEGG   Mus caroli (Ryukyu mouse): 110302833
Entry
110302833         CDS       T05910                                 

Gene name
Foxo3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04062  Chemokine signaling pathway
mcal04068  FoxO signaling pathway
mcal04137  Mitophagy - animal
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04722  Neurotrophin signaling pathway
mcal04917  Prolactin signaling pathway
mcal05213  Endometrial cancer
mcal05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110302833 (Foxo3)
   04151 PI3K-Akt signaling pathway
    110302833 (Foxo3)
   04152 AMPK signaling pathway
    110302833 (Foxo3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110302833 (Foxo3)
  09143 Cell growth and death
   04218 Cellular senescence
    110302833 (Foxo3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110302833 (Foxo3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110302833 (Foxo3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110302833 (Foxo3)
  09149 Aging
   04211 Longevity regulating pathway
    110302833 (Foxo3)
   04213 Longevity regulating pathway - multiple species
    110302833 (Foxo3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    110302833 (Foxo3)
   05223 Non-small cell lung cancer
    110302833 (Foxo3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110302833 (Foxo3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110302833 (Foxo3)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    110302833 (Foxo3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 110302833
NCBI-ProteinID: XP_021029246
Ensembl: MGP_CAROLIEiJ_G0015277
UniProt: A0A6P7RRX2
LinkDB
Position
10
AA seq 672 aa
MAEAPASPVPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
DDDEDDEDGGGQASSAMVIGGGVSSTLGSGLLLEDSAMLLAPGGQDLGSGPASAAGALSG
GTPTQLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQAAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDGPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLAENLMDDLLDNIALPPSQPSPPGGLMQRGSSFPYTAKSS
GLGSPTGSFNSTVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQDLLASDSLSH
SDVMMTQSDPLMSQASTAVSAQNARRNVMLRNDPMMSFAAQPTQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPV
MGHDKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcaccagcctccccggtcccgctctctccgctcgaagtggagctggaccca
gagttcgagccacagagtcggccacgctcctgtacgtggcccctgcagaggccggagctg
caggcgagcccggccaagccctcgggggagacggccgcagactccatgatccccgaggag
gacgacgatgaagacgatgaggacggcggcggccaagccagctcggccatggtgatcggt
ggcggcgtgagcagcacgctgggctccgggctgctcctcgaggattcggccatgctgctg
gctccaggagggcaggacctcgggtcggggccagcgtccgccgcaggcgcgctgagtggg
ggcacgccgacgcagctgcagcctcagcagccactgccaccgccgcagccgggggcggct
gggggctctgggcaaccaaggaaatgctcctcgcggcggaatgcctgggggaacctgtcc
tatgctgacctgatcacccgcgccatcgagagctccccggacaaacggctcactttgtcc
cagatctacgagtggatggtgcgctgtgtgccctacttcaaggataagggcgacagcaac
agctctgcgggctggaagaactccatccggcacaacctgtccctgcacagccgcttcatg
cgggttcagaatgaaggcaccggcaagagctcttggtggatcatcaaccccgatggggga
aagagcgggaaggccccccggcggcgtgctgtctccatggacaacagcaacaagtacacc
aagagccgaggccgggccgccaagaagaaggcggccctgcaggctgccccagagtcggca
gacgacagtccttcccagctctccaagtggcctggcagccccacgtcccgcagcagcgac
gagctggatgcttggaccgacttccgctcgcgcaccaattccaacgccagcaccgtgagc
ggccgcctgtcacccatcctggcaagcacggagctggatgacgtccaggacgatgatgga
cccctgtcccccatgctgtacagcagctctgccagcctgtcgccctccgtgagcaagccg
tgtaccgtggagcttccgcggctgacggacatggccggcaccatgaatctgaacgatggg
ctggccgagaacctcatggacgacctgctggataacatcgcgctcccgccatcgcagcca
tcgcctcctggcgggctcatgcagcggggctccagcttcccgtataccgccaagagctcc
ggcctgggctccccaaccggctccttcaacagtaccgtgtttggaccttcgtctctgaac
tccttacgtcagtcacccatgcagactatccaggagaacagaccggccaccttttcttcc
gtgtcacactacggcaaccagacactccaagacctgctcgcttcagactcactcagccac
agcgacgtcatgatgacccagtcggaccccttgatgtctcaggctagcaccgccgtgtcc
gcccagaatgcccgccggaacgtgatgcttcgcaacgacccaatgatgtcctttgctgcc
cagcctacccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctcttggtggcagccgtgccttgtcaaattctgtcagcaacatgggcttgagtgac
tccagcagccttggctcagccaaacaccagcagcagtctcccgccagccagtctatgcaa
accctctcggactctctctcaggctcctcactgtattcagctagtgcaaaccttcccgtc
atgggccacgataagttccccagtgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccatcatccgtagtgaactcatggatgctgacgggttggattttaac
tttgactccctcatctccacacagaacgttgttggtttgaacgtggggaacttcactggt
gctaagcaggcctcatctcaaagctgggtaccaggctga

DBGET integrated database retrieval system