KEGG   Mus caroli (Ryukyu mouse): 110302981
Entry
110302981         CDS       T05910                                 

Gene name
Kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04640  Hematopoietic cell lineage
mcal04916  Melanogenesis
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110302981 (Kitlg)
   04014 Ras signaling pathway
    110302981 (Kitlg)
   04015 Rap1 signaling pathway
    110302981 (Kitlg)
   04072 Phospholipase D signaling pathway
    110302981 (Kitlg)
   04151 PI3K-Akt signaling pathway
    110302981 (Kitlg)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110302981 (Kitlg)
  09152 Endocrine system
   04916 Melanogenesis
    110302981 (Kitlg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302981 (Kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110302981 (Kitlg)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110302981 (Kitlg)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 110302981
NCBI-ProteinID: XP_021029508
Ensembl: MGP_CAROLIEiJ_G0015768
LinkDB
Position
10
AA seq 313 aa
MKKTQVSRARPGGARRLSKKIAPGAPGSPARPGTGNPAMWGCALPTWIITCIYLQLLLFN
PLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLS
LTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVECMEENAPKNVKESPKRPETRSFTPEEF
FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSS
NRKAAKSPEDSGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEI
SMLQQKEREFQEV
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaagaagacacaagtgagtagggcacgcccgggaggagctcggaggctttccaagaaa
atcgctccgggagccccggggagcccggcgcgccctgggaccggcaacccggccatgtgg
ggctgcgccctcccgacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaaccaaggagatctgcgggaatcctgtgactgataatgtaaaagacatt
acaaaactggtggcaaatcttccaaatgactatatgataaccctcaactatgtcgccggg
atggatgttttgcctagtcattgttggctacgagatatggtaatacaattatcactcagc
ttgactactcttctggacaagttctcaaatatttctgaaggcttgagtaattactccatc
atagacaaacttgggaaaatagtggatgacctcgtggaatgcatggaagaaaacgcaccg
aagaatgtaaaagaatctccgaagaggccagaaactagatcctttactcctgaagaattc
tttagtattttcaatagatccattgatgcctttaaggactttatggtggcatctgacact
agtgactgtgtgctctcttcaacattaggtcccgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaagccgcaaagtcccctgaagactcgggtctacaatggacagccatggcattg
ccggctctcatttcacttgtaattggctttgcttttggagccttatactggaagaagaaa
cagtcaagtcttacaagggcagttgaaaatatacagattaatgaagaggataatgagata
agtatgttgcaacagaaagagagagaatttcaagaggtgtaa

DBGET integrated database retrieval system