KEGG   Mus caroli (Ryukyu mouse): 110303039
Entry
110303039         CDS       T05910                                 

Gene name
Esr1
Definition
(RefSeq) estrogen receptor isoform X1
  KO
K08550  estrogen receptor alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04961  Endocrine and other factor-regulated calcium reabsorption
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110303039 (Esr1)
   04917 Prolactin signaling pathway
    110303039 (Esr1)
   04919 Thyroid hormone signaling pathway
    110303039 (Esr1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    110303039 (Esr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303039 (Esr1)
   05205 Proteoglycans in cancer
    110303039 (Esr1)
  09162 Cancer: specific types
   05224 Breast cancer
    110303039 (Esr1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110303039 (Esr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110303039 (Esr1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110303039 (Esr1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    110303039 (Esr1)
Nuclear receptors [BR:mcal03310]
 3. Estrogen like
  3A. Estrogen receptor
   110303039 (Esr1)
SSDB
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Other DBs
NCBI-GeneID: 110303039
NCBI-ProteinID: XP_021029593
Ensembl: MGP_CAROLIEiJ_G0015086
UniProt: A0A6P5QGQ3
LinkDB
Position
10
AA seq 598 aa
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAY
EFNAAAAAAAASAPVYSQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQL
SPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNPDNRRQNGRERLSSSNEKGNMVME
SAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSC
QACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDIRAANLWPSPLV
IKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELVHM
INWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKC
VEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHR
VLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLY
DLLLEMLDAHRLHAPASRMGVPPEEPSQNQLATTSSTSAHSLQTYYIPPEAESFPNTI
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgaccatgacccttcacaccaaagcctcgggaatggccttgctgcaccagatccaaggg
aacgagctggagcccctcaaccgcccgcagctcaagatgcccatggagagggccctgggc
gaggtatacgtggacaacagcaagcccactgtgttcaactaccccgagggcgccgcctac
gagttcaacgccgccgccgccgccgccgccgcctcggcgccggtctacagccagtcaggc
atcgcctacggccccgggtccgaggcggccgccttcagtgccaacagcctgggggctttc
ccccagctcaacagcgtgtcgcctagcccgcttatgctgctgcacccgccgccgcagctg
tctcctttcctgcacccgcacggccagcaggtgccctactacctggagaacgagcccagc
gcctacgccgtgcgcgacaccggccctcccgccttctacaggtctaatcctgacaatcga
cgccagaatggccgagagagactgtccagcagtaacgagaaaggaaacatggtcatggag
tctgccaaggagactcgctactgtgccgtgtgcaatgactatgcctctggctaccattat
ggggtctggtcctgcgaaggctgcaaggctttctttaagagaagcattcaaggacacaat
gactacatgtgtccagctacaaaccaatgcaccattgacaagaaccggaggaagagttgc
caggcctgccggctgcgcaagtgttacgaagtgggcatgatgaaaggtgggatacggaaa
gaccgccgaggagggagaatgttgaagcacaagcgtcagagagatgacttggaaggccgg
aatgaaatgggtgcttcaggagacatcagggcagccaacctttggccaagccctcttgtg
attaagcacactaagaagaatagccctgccttgtccttgacagctgaccagatggtcagt
gccttgttggatgctgaaccgcccttgatctattctgaatatgatccttctagacccttc
agtgaagcctcaatgatgggcttattgaccaacctggcagacagggagctggttcatatg
atcaactgggcaaagagagtgccaggctttggggacttgaatctccatgatcaggtccac
cttctcgagtgtgcctggctggagattctgatgattggtctcgtctggcgctccatggaa
cacccggggaagctcctgtttgctcctaacttgctcctggacaggaatcaaggtaaatgt
gtggaaggcatggtagagatctttgacatgttgctggctacatcaagtcggttccgcatg
atgaacctgcagggagaagagtttgtgtgcctcaaatccatcattttgcttaattccgga
gtgtatacgtttctgtccagcaccttgaagtctctggaagagaaggaccacatccaccgt
gtcctggacaagatcacagacactttgatccacctgatggccaaagctggcctgacactg
cagcagcagcatcgccgcctagctcagctccttctcattctttcccatatccggcacatg
agtaacaaaggcatggagcatctctacaacatgaaatgcaagaacgtcgtgcccctctat
gacctgctcctggagatgttggatgcccaccgccttcatgccccagccagtcgcatggga
gtgcccccagaggagcccagccagaaccagctggccaccaccagctccacttcagcacat
tccttacaaacctactacatacccccggaagcagagagcttccccaacacgatctga

KEGG   Mus caroli (Ryukyu mouse): 110307047
Entry
110307047         CDS       T05910                                 

Gene name
Esr2
Definition
(RefSeq) estrogen receptor beta isoform X1
  KO
K08551  estrogen receptor beta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04929  GnRH secretion
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    110307047 (Esr2)
   04915 Estrogen signaling pathway
    110307047 (Esr2)
   04917 Prolactin signaling pathway
    110307047 (Esr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110307047 (Esr2)
  09162 Cancer: specific types
   05224 Breast cancer
    110307047 (Esr2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110307047 (Esr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110307047 (Esr2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110307047 (Esr2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    110307047 (Esr2)
Nuclear receptors [BR:mcal03310]
 3. Estrogen like
  3A. Estrogen receptor
   110307047 (Esr2)
SSDB
Motif
Pfam: ERbeta_N Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 110307047
NCBI-ProteinID: XP_021034917
Ensembl: MGP_CAROLIEiJ_G0017859
UniProt: A0A6P5QMB6
LinkDB
Position
12
AA seq 567 aa
MSICASSHKDFSQLRPTQDMEIKNSPSSLTSPASYNCSQSILPLEHGPIYIPSSYVESRH
EYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWPTSGHLSPLATHCQSSLLYAE
PQKSPWCEARSLEHTLPVNRETLKRKLSGSGCASPVTSPNAKRDAHFCAVCSDYASGYHY
GVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRR
ERCGYRIVRRQRSASEQVHCLNKAKRTSGHTPRVKELLLSSLSPEQLVLSLLEAEPPNVL
VSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLLDQVRLLESCWMEVLMV
GLMWRSIDHPGKLIFAPDLVLDRSSEDPHWHVAQTKSAVPRDEGKCVEGILEIFDMLLAT
TARFRELKLQHKEYLCVKAMILLNSSMYPLATASQEAESSRKLTHLLNAVTDALVWVISK
SGISSQQQSVRLANLLMLLSHVRHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGY
KSSISGSECCSTEDSKSKESSQNLQSQ
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgtccatctgtgcctcttctcacaaggatttttctcagctgcggcctacgcaagacatg
gagatcaaaaactcaccatcaagccttacttcccccgcttcttataactgtagccagtcc
atcctgcccttggagcatggccccatctatatcccttcctcctatgtagagagccgtcac
gaatactcagccatgacattctacagtcctgctgtgatgaactacagtgtccccagcagc
accggtaacctggaaggtgggcctgtccgccagaccgcaagcccaaatgtgctatggcca
acttctggacacctctctcctttagccacccactgccaatcatcgcttctctatgcagaa
cctcaaaagagtccttggtgtgaagcaagatcactagaacacaccttacctgtaaacaga
gagacactgaagaggaagcttagcggcagcggttgtgccagccctgttactagtccaaac
gccaagagggatgctcacttctgcgctgtctgcagtgattacgcatctgggtatcattac
ggtgtctggtcctgtgaaggatgtaaggccttttttaaaagaagcattcaaggacataat
gactatatctgcccagccacgaatcagtgtaccatagacaagaaccggcgtaaaagctgc
caggcctgccgacttcgcaagtgttatgaagtaggaatggtcaagtgtggatccaggaga
gaaaggtgtgggtaccgaatagtacgaagacagagaagtgccagtgagcaggtgcattgc
ctgaacaaagccaagagaaccagtgggcacacaccccgggtgaaggagctgctgctgagc
tctctgagtcccgagcagctggtgctcagcctgctggaagctgagccacccaatgtgcta
gtgagccgtcccagcatgcccttcaccgaggcctccatgatgatgtccctcacgaagctg
gctgacaaggaactggtgcacatgattggctgggccaagaaaatccctggctttgtggag
ctcagcctgttggatcaagtccgtctcttggaaagctgctggatggaggtgctgatggtg
gggctgatgtggcgctccatcgaccaccccggcaagctcatctttgctccagacctcgtt
ctggacaggtcctcagaagaccctcactggcacgttgcgcagacgaagagtgctgtccca
agggatgaggggaagtgcgtagaagggattctggaaatctttgacatgctcctggcgacg
acggcacggttccgtgagttaaaactgcagcacaaagaatatctgtgtgtgaaggccatg
attctcctcaactccagtatgtaccccttggctaccgcaagccaggaagcagagagtagc
cggaagctgacacacctattgaacgcagtgacagatgccctggtctgggtgatttcgaag
agtggtatctcttcccagcagcagtcagtccgtctggccaacctcctgatgcttctttct
catgtcaggcacatcagtaacaaaggcatggaacatctgctcagcatgaagtgcaaaaat
gtggtgccagtgtacgacctgctgctggagatgctgaatgctcacacacttcgagggtac
aagtcctcaatctcggggtctgagtgctgctcgacagaggacagtaagagcaaagagagc
tcccagaacctccagtcacagtga

DBGET integrated database retrieval system