KEGG   Mus caroli (Ryukyu mouse): 110303221
Entry
110303221         CDS       T05910                                 

Gene name
Cdk2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04115  p53 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04218  Cellular senescence
mcal04914  Progesterone-mediated oocyte maturation
mcal04934  Cushing syndrome
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05215  Prostate cancer
mcal05222  Small cell lung cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110303221 (Cdk2)
   04151 PI3K-Akt signaling pathway
    110303221 (Cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110303221 (Cdk2)
   04114 Oocyte meiosis
    110303221 (Cdk2)
   04115 p53 signaling pathway
    110303221 (Cdk2)
   04218 Cellular senescence
    110303221 (Cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    110303221 (Cdk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303221 (Cdk2)
   05203 Viral carcinogenesis
    110303221 (Cdk2)
  09162 Cancer: specific types
   05226 Gastric cancer
    110303221 (Cdk2)
   05215 Prostate cancer
    110303221 (Cdk2)
   05222 Small cell lung cancer
    110303221 (Cdk2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110303221 (Cdk2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110303221 (Cdk2)
   05161 Hepatitis B
    110303221 (Cdk2)
   05160 Hepatitis C
    110303221 (Cdk2)
   05162 Measles
    110303221 (Cdk2)
   05169 Epstein-Barr virus infection
    110303221 (Cdk2)
   05165 Human papillomavirus infection
    110303221 (Cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110303221 (Cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcal03032]
    110303221 (Cdk2)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110303221 (Cdk2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110303221 (Cdk2)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110303221 (Cdk2)
DNA replication proteins [BR:mcal03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110303221 (Cdk2)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110303221 (Cdk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 110303221
NCBI-ProteinID: XP_021029890
Ensembl: MGP_CAROLIEiJ_G0015950
UniProt: A0A6P5QHF5
LinkDB
Position
10
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
APHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaggtggagaagattggagagggcacgtacggagtggtgtacaaa
gccaaaaacaagttgacgggagaagttgtggcgcttaagaagatccggctcgacactgag
actgaaggtgtacccagtactgccatccgagagatctctctccttaaggaacttaatcac
cctaatatcgtcaagctgctggatgtcatccacacagaaaataagctctatctggttttt
gaatttctgcaccaggacctcaagaaatttatggatgcctctgctctcacgggcattcct
ctacccctcattaagagctatctgttccagctgctccagggcctggcattctgccattct
caccgtgtccttcaccgagaccttaagccccagaacctgcttatcaatgcagaggggtcc
atcaagctggcagactttggactagcaagagcctttggagtccctgtccgaacttacact
catgaggtggtgaccctgtggtaccgagcacctgaaattcttctgggctgcaagtactac
tccacagccgtggatatctggagcctgggctgcatctttgctgaaatgcacctagtgtgt
acccagcaccatgctaagtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
gccccacaccccgtgacccgcagggccctattccctggagattctgagattgaccaactc
ttcaggatctttcggactctggggacccctgatgaggtggtttggccaggagttacttct
atgcctgattataagccaagtttccccaagtgggctcggcaagattttagcaaagttgtg
cctcctctagatgaagatggacggagcttgttatcgcaaatgctgcactatgaccccaac
aagcggatttcagccaaagcagccctggctcaccctttcttccaggatgtgactaagcca
gtgccccaccttcggctctga

DBGET integrated database retrieval system