KEGG   Mus caroli (Ryukyu mouse): 110303375
Entry
110303375         CDS       T05910                                 

Gene name
Socs2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04630  JAK-STAT signaling pathway
mcal04910  Insulin signaling pathway
mcal04917  Prolactin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110303375 (Socs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110303375 (Socs2)
   04917 Prolactin signaling pathway
    110303375 (Socs2)
   04935 Growth hormone synthesis, secretion and action
    110303375 (Socs2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110303375 (Socs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110303375 (Socs2)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110303375 (Socs2)
SSDB
Motif
Pfam: SH2 SOCS_box SH2_2 Condensation
Other DBs
NCBI-GeneID: 110303375
NCBI-ProteinID: XP_021030147
Ensembl: MGP_CAROLIEiJ_G0015748
UniProt: A0A6P7RDL9
LinkDB
Position
10
AA seq 198 aa
MTLRCLEPSGNGADRTRSQWGTAGLPEEQSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLAINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctggagccctccgggaatggagcggacaggacgcggagccagtgg
gggaccgcggggttgccggaggaacagtcccccgaggcggcgcgtctggcgaaagccctg
cgtgagctcagtcaaacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggctccagaaggaactttcttgattagagatagttcgcattcagactac
ctgctaactatatccgtgaagacgtcagctggaccgactaacctgcggattgagtatcaa
gatgggaaattcagattggattctatcatatgcgtcaagtccaagcttaaacagtttgac
agtgtggttcatctgattgactactatgtccagatgtgcaaggataaacggacaggccca
gaagccccacggaatgggactgttcacctgtacctgaccaaacctctgtatacatcagca
ccgactctgcagcatttctgtcgactcgccattaacaaatgtaccggtacgatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Mus caroli (Ryukyu mouse): 110304930
Entry
110304930         CDS       T05910                                 

Gene name
Socs3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04120  Ubiquitin mediated proteolysis
mcal04380  Osteoclast differentiation
mcal04630  JAK-STAT signaling pathway
mcal04668  TNF signaling pathway
mcal04910  Insulin signaling pathway
mcal04917  Prolactin signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04935  Growth hormone synthesis, secretion and action
mcal05160  Hepatitis C
mcal05164  Influenza A
mcal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110304930 (Socs3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110304930 (Socs3)
   04668 TNF signaling pathway
    110304930 (Socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110304930 (Socs3)
   04920 Adipocytokine signaling pathway
    110304930 (Socs3)
   04917 Prolactin signaling pathway
    110304930 (Socs3)
   04935 Growth hormone synthesis, secretion and action
    110304930 (Socs3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110304930 (Socs3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110304930 (Socs3)
   04932 Non-alcoholic fatty liver disease
    110304930 (Socs3)
   04931 Insulin resistance
    110304930 (Socs3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110304930 (Socs3)
   05164 Influenza A
    110304930 (Socs3)
   05168 Herpes simplex virus 1 infection
    110304930 (Socs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110304930 (Socs3)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110304930 (Socs3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 110304930
NCBI-ProteinID: XP_021032286
Ensembl: MGP_CAROLIEiJ_G0017476
UniProt: A0A6P5QMZ9
LinkDB
Position
11
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaaaagcgagtaccagctggtggtgaacgccgtgcgcaag
ctgcaggagagcggattctactggagcgccgtgaccggcggcgaggcgaacctgctgctc
agcgccgagcccgcgggcacctttcttatccgcgacagttcggaccagcgccacttcttc
acgctgagcgtcaagacccagtcggggaccaagaacctacgcatccagtgcgaggggggc
agcttttcgctgcagagtgacccccgaagcacgcagccagttccccgcttcgactgtgta
ctcaagctggtgcaccactacatgccgcccccagggaccccctccttttctttgccaccc
acggaaccctcctccgaagttccggagcagccacctgcccaggcactccccgggagtacc
cccaagagagcttactacatctattctgggggcgagaagattccgctggtactgagccga
cctctctcctccaacgtggccaccctccagcatctttgtcgcaagactgtcaacggccac
ctggactcctatgagaaagtgacccagctgcctggacccattcgggagttcctggaccag
tatgatgctccactttaa

KEGG   Mus caroli (Ryukyu mouse): 110309072
Entry
110309072         CDS       T05910                                 

Gene name
Socs4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04630  JAK-STAT signaling pathway
mcal04910  Insulin signaling pathway
mcal04917  Prolactin signaling pathway
mcal04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110309072 (Socs4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110309072 (Socs4)
   04917 Prolactin signaling pathway
    110309072 (Socs4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110309072 (Socs4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110309072 (Socs4)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110309072 (Socs4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 110309072
NCBI-ProteinID: XP_021037126
Ensembl: MGP_CAROLIEiJ_G0019164
UniProt: A0A6P5QZD8
LinkDB
Position
14
AA seq 436 aa
MAENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSESEAISTVDNVEIPLR
SQERQLSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSGRHSPGLPSKRKIH
ISELMLDKCPFPPRSDLAFRWHFIKRHTVPISPNSDEWVSADLSESKLRDAQLKRRNTED
DITCFSHTNVQPCVVTANSASCTGGHITGSMMNLVTNNSIEDSDMDSEDEIITLCTSSRK
RNKPRWEMDEEILQLEAPPKFHTQIDYVHCLVPDLLQISNNPCYWGVMDKYAAEALLEGK
PEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEH
YKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSPMKLYLKEYH
YKSKVRLLRIDVPEQQ
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggctgaaaacaatagtaaaaatgtagatgtacggcctaaaacaagtcggagtcgaagt
gctgacaggaaggatggttatgtgtggagtggaaagaagttgtcttggtccaaaaagagt
gagagttgttctgaatctgaagccataagtactgttgacaatgttgaaattcctctaaga
agccaggaaaggcagcttagctgttcgtccattgagttggacttagatcattcctgtggg
catagatttttaggccgatcccttaaacagaaactgcaagatgcagtggggcagtgtttt
ccgataaagaattgtagtggccgacactctccagggcttccatctaaaagaaagattcat
atcagtgaactcatgttagataagtgccctttcccacctcgctcagatttagcctttagg
tggcattttattaaacgacacactgttcctataagtcccaactcagatgaatgggtgagt
gcagacctgtccgagagtaaattgagagatgctcagctgaaacgaagaaacacagaagat
gacataacctgtttctcacataccaatgtccagccttgtgtcgtaactgccaacagtgct
tcgtgtacaggtggtcacataactggttctatgatgaacttggtcacaaacaacagcata
gaagacagtgacatggattcagaggatgaaattataacgctgtgcacaagctccagaaaa
aggaataagcccaggtgggaaatggacgaggagatcctgcagttggaggcacctcctaag
ttccacacccagatcgactacgtccactgccttgttccagacctccttcagatcagtaac
aatccgtgctactggggtgtcatggacaaatatgcagccgaagctctgctggaaggaaag
ccagagggcacctttttacttcgagattcggcgcaggaagattatttattctctgttagt
tttagacgctacagtcgttctcttcatgctagaattgagcagtggaatcataactttagc
tttgatgcccatgatccttgtgtcttccattcccctgatattactgggctcctggaacac
tataaggaccccagtgcctgtatgttctttgagccgctcttgtccactcccttaatccgg
acgttccccttttccttgcagcatatttgcagaacagttatttgtaattgtacgacttac
gatggcatcgatgcccttcccattccttcgcctatgaaattgtatctgaaggaataccat
tataaatcaaaagttaggctactcaggattgatgtgccagagcagcagtga

KEGG   Mus caroli (Ryukyu mouse): 110311816
Entry
110311816         CDS       T05910                                 

Gene name
Socs1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04120  Ubiquitin mediated proteolysis
mcal04380  Osteoclast differentiation
mcal04630  JAK-STAT signaling pathway
mcal04910  Insulin signaling pathway
mcal04917  Prolactin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04935  Growth hormone synthesis, secretion and action
mcal05145  Toxoplasmosis
mcal05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110311816 (Socs1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110311816 (Socs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110311816 (Socs1)
   04917 Prolactin signaling pathway
    110311816 (Socs1)
   04935 Growth hormone synthesis, secretion and action
    110311816 (Socs1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110311816 (Socs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110311816 (Socs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110311816 (Socs1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110311816 (Socs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110311816 (Socs1)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110311816 (Socs1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 110311816
NCBI-ProteinID: XP_021041024
Ensembl: MGP_CAROLIEiJ_G0020447
UniProt: A0A6P5R7Y7
LinkDB
Position
16
AA seq 212 aa
MVARNQVAADNAISPAAEPRRRPEPSSSSSSSSPAAPVRPRPCPAVPAPAPGDTHFRTFR
SHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKM
ASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCR
QRIVAAVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 639 nt   +upstreamnt  +downstreamnt
atggtagcacgcaaccaggtggcagccgacaatgcgatctccccggcagcagagcccaga
cggcggccagagccctcctcgtcctcgtcttcgtcctcgccagcggcccccgtgcgtccc
cggccctgccccgcggtcccggccccggccccgggcgacactcacttccgcaccttccgc
tcccactccgattaccggcgcatcacgcggaccagcgcgctcctggacgcctgcggcttc
tattggggacccctgagcgtgcacggggcgcacgagcggctgcgtgccgagcccgtgggc
accttcttggtgcgcgacagtcgccaacgaaactgcttcttcgcgctcagcgtgaagatg
gcttcgggccccacgagcatccgcgtgcacttccaggccggccgcttccacttggacggc
agccgcgagaccttcgactgccttttcgagctgctggagcactacgtggcggcgccgcgc
cgcatgttgggggccccgctgcgccagcgccgcgtgcggccgctgcaggagctgtgtcgc
cagcgcatcgtggccgccgtgggtcgcgagaacctggcgcgcatccctcttaacccggta
ctccgtgactacctgagttccttccccttccagatctga

DBGET integrated database retrieval system