KEGG   Mus caroli (Ryukyu mouse): 110303672
Entry
110303672         CDS       T05910                                 

Gene name
Hmga2
Definition
(RefSeq) high mobility group protein HMGI-C
  KO
K09283  high mobility group AT-hook protein 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05202  Transcriptional misregulation in cancer
mcal05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110303672 (Hmga2)
   05206 MicroRNAs in cancer
    110303672 (Hmga2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110303672 (Hmga2)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110303672 (Hmga2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Other transcription factors
   HMGI(Y)
    110303672 (Hmga2)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    110303672 (Hmga2)
SSDB
Motif
Pfam: AT_hook
Other DBs
NCBI-GeneID: 110303672
NCBI-ProteinID: XP_021030508
UniProt: A0A6P5QKL8
LinkDB
Position
10
AA seq 108 aa
MSARGEGAGQPSTSSQGQPAALVPQKRGRGRPRKQLQETTCEPSPKRPRGRPKGSKNKSP
SKAAQKKAETIGEKRPRGRPRKWPQQVVQKKPAQETEETSSQESAEED
NT seq 327 nt   +upstreamnt  +downstreamnt
atgagcgcacgcggtgagggcgccgggcagccgtccacatcatcccagggacaacctgcc
gccctggtgccacagaagcgaggacgcggccgacccaggaagcagctgcaagagacaacc
tgtgagccctctcctaagagacccagaggaagacccaaaggcagcaaaaacaagagcccc
tctaaagcagcccagaagaaagcagagaccattggagaaaaacggccaagaggcagacct
aggaaatggccacaacaagtcgttcagaagaagcctgctcaggagaccgaagagacatcc
tcgcaagagtctgcagaggaggattag

DBGET integrated database retrieval system