KEGG   Mus caroli (Ryukyu mouse): 110303712
Entry
110303712         CDS       T05910                                 

Gene name
Mdm2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04115  p53 signaling pathway
mcal04120  Ubiquitin mediated proteolysis
mcal04144  Endocytosis
mcal04151  PI3K-Akt signaling pathway
mcal04218  Cellular senescence
mcal04625  C-type lectin receptor signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110303712 (Mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110303712 (Mdm2)
   04151 PI3K-Akt signaling pathway
    110303712 (Mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110303712 (Mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    110303712 (Mdm2)
   04115 p53 signaling pathway
    110303712 (Mdm2)
   04218 Cellular senescence
    110303712 (Mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110303712 (Mdm2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110303712 (Mdm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303712 (Mdm2)
   05202 Transcriptional misregulation in cancer
    110303712 (Mdm2)
   05206 MicroRNAs in cancer
    110303712 (Mdm2)
   05205 Proteoglycans in cancer
    110303712 (Mdm2)
   05203 Viral carcinogenesis
    110303712 (Mdm2)
  09162 Cancer: specific types
   05214 Glioma
    110303712 (Mdm2)
   05220 Chronic myeloid leukemia
    110303712 (Mdm2)
   05218 Melanoma
    110303712 (Mdm2)
   05219 Bladder cancer
    110303712 (Mdm2)
   05215 Prostate cancer
    110303712 (Mdm2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110303712 (Mdm2)
   05169 Epstein-Barr virus infection
    110303712 (Mdm2)
   05165 Human papillomavirus infection
    110303712 (Mdm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110303712 (Mdm2)
   01522 Endocrine resistance
    110303712 (Mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110303712 (Mdm2)
   04121 Ubiquitin system [BR:mcal04121]
    110303712 (Mdm2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110303712 (Mdm2)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    110303712 (Mdm2)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    110303712 (Mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 110303712
NCBI-ProteinID: XP_021030567
Ensembl: MGP_CAROLIEiJ_G0015836
UniProt: A0A6P5QKR3
LinkDB
Position
10
AA seq 494 aa
MCNTNMSVSTEGAASTSQIPASEQETLVRPKPLLLKLLKSVGAQNDTYTMKEIIFYIGQY
IMTKRLYDEKQQHIVYCSNDLLGDVFGVPSFSVKEHRKIYAMIYRNLVAVSQQDSGTSLR
ESRCQPEGGSDLKDPVQAPPEEKPSSSDLVSRPSTSSRRRSISETEENTGELPGERHRKR
RRSLSFDPSLGLCELREICCDGGGGSSSSSSSSSSSESTETPSHQDLDDGVSEHSGDCLD
QDSVSDQFSVEFEVESLDSEDYSLSDEGHELSDEDDEVYRVTVYQTGESDTDSFEGDPEI
SLADYWKCTSCSEMNPPLPSHCKRCWTLRENWLPEDKGKEKVEISEKAKLENSAQAEEGL
DVPDGKKLTENDAKEPCAEEDSEEKAEQTPLSQESDDYSQPSTSSSIVYSSQESVKELRE
ETQDKEESVESSFSLNAVEPCVICQGRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPV
CRQPIQMIVLTYFN
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctaccgagggtgctgcaagcacctcacagattcca
gcttcggaacaagagactctggttagaccaaaaccattgcttttgaagttgttaaagtcc
gttggagcacaaaacgatacttacactatgaaagagattatattttatattggccagtat
attatgactaagaggttatatgacgagaagcagcagcacattgtgtattgttcaaatgat
ctcctaggagatgtgtttggagtcccaagtttctctgtgaaggagcacaggaaaatatat
gcaatgatctacagaaatttagtggctgtaagtcagcaagactctggcacatcactgaga
gagagcagatgtcagcctgaaggtgggagtgacctgaaggaccctgtgcaagcgccacca
gaagagaaaccttcatcttctgatttagtttctagaccgtctacctcatctagaaggaga
tccattagtgagacagaagagaacacaggtgagctacctggtgaacggcaccggaagcgc
cgcaggtccctgtcctttgatccgagcctgggtctatgtgagctgagggagatatgctgt
gatggtggcggtggcagcagcagtagcagcagcagcagcagcagcagcgagtccacagag
acgccctcgcatcaggatcttgacgatggcgtaagtgagcattctggtgattgcctggat
caggattcagtttctgatcagtttagtgtggaatttgaagttgagtctctcgactcggaa
gattacagcctgagtgacgaagggcacgagctctcagatgaggatgacgaggtctatcgg
gtcacagtctatcagacaggagagagcgatacagactcttttgagggagatcctgagatt
tccttagctgactattggaaatgtacctcatgcagtgaaatgaatcctccccttccatca
cactgcaaaaggtgctggacccttcgtgagaactggcttccagaagataaggggaaagag
aaagtggaaatctctgaaaaagccaaactggaaaactcagctcaggcagaagaaggcttg
gatgtgcctgatggcaaaaagctgacagagaatgatgctaaggagccatgtgctgaggag
gacagcgaggagaaggccgaacagacgcccctgtcccaggagagtgacgactattcccaa
ccgtcgacttccagcagcattgtttatagcagccaagaaagcgtgaaagagttgagggag
gaaacgcaggacaaagaggagagtgtggaatctagcttctccctgaatgcngtcgaacca
tgtgtgatctgccaggggcggcctaaaaatggctgcattgtccacggcaagactggacac
ctcatgtcgtgtttcacgtgtgcaaagaagctaaaaaaaagaaacaagccctgcccagtg
tgcagacagccaatccaaatgattgtgctaacttacttcaactag

DBGET integrated database retrieval system